I: pbuilder: network access will be disabled during build I: Current time: Sat Jun 14 04:18:18 +14 2025 I: pbuilder-time-stamp: 1749824298 I: Building the build Environment I: extracting base tarball [/var/cache/pbuilder/trixie-reproducible-base.tgz] I: copying local configuration W: --override-config is not set; not updating apt.conf Read the manpage for details. I: mounting /proc filesystem I: mounting /sys filesystem I: creating /{dev,run}/shm I: mounting /dev/pts filesystem I: redirecting /dev/ptmx to /dev/pts/ptmx I: policy-rc.d already exists I: Copying source file I: copying [milib_2.2.0+dfsg-1.dsc] I: copying [./milib_2.2.0+dfsg.orig.tar.xz] I: copying [./milib_2.2.0+dfsg-1.debian.tar.xz] I: Extracting source gpgv: Signature made Fri Dec 30 14:08:01 2022 gpgv: using RSA key 33CB284313E90BD27DCB4523600316A6DC277476 gpgv: Can't check signature: No public key dpkg-source: warning: cannot verify inline signature for ./milib_2.2.0+dfsg-1.dsc: no acceptable signature found dpkg-source: info: extracting milib in milib-2.2.0+dfsg dpkg-source: info: unpacking milib_2.2.0+dfsg.orig.tar.xz dpkg-source: info: unpacking milib_2.2.0+dfsg-1.debian.tar.xz dpkg-source: info: using patch list from debian/patches/series dpkg-source: info: applying build_gradle.patch dpkg-source: info: applying guava_interface.patch dpkg-source: info: applying deactivate_test_reading_build_properties.patch dpkg-source: info: applying flaky_test.patch I: Not using root during the build. I: Installing the build-deps I: user script /srv/workspace/pbuilder/3151131/tmp/hooks/D01_modify_environment starting debug: Running on codethink03-arm64. I: Changing host+domainname to test build reproducibility I: Adding a custom variable just for the fun of it... I: Changing /bin/sh to bash '/bin/sh' -> '/bin/bash' lrwxrwxrwx 1 root root 9 Jun 13 14:18 /bin/sh -> /bin/bash I: Setting pbuilder2's login shell to /bin/bash I: Setting pbuilder2's GECOS to second user,second room,second work-phone,second home-phone,second other I: user script /srv/workspace/pbuilder/3151131/tmp/hooks/D01_modify_environment finished I: user script /srv/workspace/pbuilder/3151131/tmp/hooks/D02_print_environment starting I: set BASH=/bin/sh BASHOPTS=checkwinsize:cmdhist:complete_fullquote:extquote:force_fignore:globasciiranges:globskipdots:hostcomplete:interactive_comments:patsub_replacement:progcomp:promptvars:sourcepath BASH_ALIASES=() BASH_ARGC=() BASH_ARGV=() BASH_CMDS=() BASH_LINENO=([0]="12" [1]="0") BASH_LOADABLES_PATH=/usr/local/lib/bash:/usr/lib/bash:/opt/local/lib/bash:/usr/pkg/lib/bash:/opt/pkg/lib/bash:. BASH_SOURCE=([0]="/tmp/hooks/D02_print_environment" [1]="/tmp/hooks/D02_print_environment") BASH_VERSINFO=([0]="5" [1]="2" [2]="21" [3]="1" [4]="release" [5]="aarch64-unknown-linux-gnu") BASH_VERSION='5.2.21(1)-release' BUILDDIR=/build/reproducible-path BUILDUSERGECOS='second user,second room,second work-phone,second home-phone,second other' BUILDUSERNAME=pbuilder2 BUILD_ARCH=arm64 DEBIAN_FRONTEND=noninteractive DEB_BUILD_OPTIONS='buildinfo=+all reproducible=+all parallel=12 ' DIRSTACK=() DISTRIBUTION=trixie EUID=0 FUNCNAME=([0]="Echo" [1]="main") GROUPS=() HOME=/root HOSTNAME=i-capture-the-hostname HOSTTYPE=aarch64 HOST_ARCH=arm64 IFS=' ' INVOCATION_ID=f8ca48d113594afbba58d018a91271f8 LANG=C LANGUAGE=nl_BE:nl LC_ALL=C MACHTYPE=aarch64-unknown-linux-gnu MAIL=/var/mail/root OPTERR=1 OPTIND=1 OSTYPE=linux-gnu PATH=/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path PBCURRENTCOMMANDLINEOPERATION=build PBUILDER_OPERATION=build PBUILDER_PKGDATADIR=/usr/share/pbuilder PBUILDER_PKGLIBDIR=/usr/lib/pbuilder PBUILDER_SYSCONFDIR=/etc PIPESTATUS=([0]="0") POSIXLY_CORRECT=y PPID=3151131 PS4='+ ' PWD=/ SHELL=/bin/bash SHELLOPTS=braceexpand:errexit:hashall:interactive-comments:posix SHLVL=3 SUDO_COMMAND='/usr/bin/timeout -k 24.1h 24h /usr/bin/ionice -c 3 /usr/bin/nice -n 11 /usr/bin/unshare --uts -- /usr/sbin/pbuilder --build --configfile /srv/reproducible-results/rbuild-debian/r-b-build.h7UWpJjn/pbuilderrc_KKEd --distribution trixie --hookdir /etc/pbuilder/rebuild-hooks --debbuildopts -b --basetgz /var/cache/pbuilder/trixie-reproducible-base.tgz --buildresult /srv/reproducible-results/rbuild-debian/r-b-build.h7UWpJjn/b2 --logfile b2/build.log milib_2.2.0+dfsg-1.dsc' SUDO_GID=109 SUDO_UID=104 SUDO_USER=jenkins TERM=unknown TZ=/usr/share/zoneinfo/Etc/GMT-14 UID=0 USER=root _='I: set' http_proxy=http://192.168.101.4:3128 I: uname -a Linux i-capture-the-hostname 6.1.0-21-cloud-arm64 #1 SMP Debian 6.1.90-1 (2024-05-03) aarch64 GNU/Linux I: ls -l /bin lrwxrwxrwx 1 root root 7 Jun 12 17:48 /bin -> usr/bin I: user script /srv/workspace/pbuilder/3151131/tmp/hooks/D02_print_environment finished -> Attempting to satisfy build-dependencies -> Creating pbuilder-satisfydepends-dummy package Package: pbuilder-satisfydepends-dummy Version: 0.invalid.0 Architecture: arm64 Maintainer: Debian Pbuilder Team Description: Dummy package to satisfy dependencies with aptitude - created by pbuilder This package was created automatically by pbuilder to satisfy the build-dependencies of the package being currently built. Depends: debhelper-compat (= 13), default-jdk, gradle-debian-helper, javahelper, maven-repo-helper, junit4, libcommons-compress-java, libcommons-io-java, libcommons-math3-java, libguava-java, libjackson2-annotations-java, libjackson2-core-java, libjackson2-databind-java, libjcommander-java, liblz4-java, libmockito-java, libredberry-pipe-java, libtrove3-java dpkg-deb: building package 'pbuilder-satisfydepends-dummy' in '/tmp/satisfydepends-aptitude/pbuilder-satisfydepends-dummy.deb'. Selecting previously unselected package pbuilder-satisfydepends-dummy. (Reading database ... 19744 files and directories currently installed.) Preparing to unpack .../pbuilder-satisfydepends-dummy.deb ... Unpacking pbuilder-satisfydepends-dummy (0.invalid.0) ... dpkg: pbuilder-satisfydepends-dummy: dependency problems, but configuring anyway as you requested: pbuilder-satisfydepends-dummy depends on debhelper-compat (= 13); however: Package debhelper-compat is not installed. pbuilder-satisfydepends-dummy depends on default-jdk; however: Package default-jdk is not installed. pbuilder-satisfydepends-dummy depends on gradle-debian-helper; however: Package gradle-debian-helper is not installed. pbuilder-satisfydepends-dummy depends on javahelper; however: Package javahelper is not installed. pbuilder-satisfydepends-dummy depends on maven-repo-helper; however: Package maven-repo-helper is not installed. pbuilder-satisfydepends-dummy depends on junit4; however: Package junit4 is not installed. pbuilder-satisfydepends-dummy depends on libcommons-compress-java; however: Package libcommons-compress-java is not installed. pbuilder-satisfydepends-dummy depends on libcommons-io-java; however: Package libcommons-io-java is not installed. pbuilder-satisfydepends-dummy depends on libcommons-math3-java; however: Package libcommons-math3-java is not installed. pbuilder-satisfydepends-dummy depends on libguava-java; however: Package libguava-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-annotations-java; however: Package libjackson2-annotations-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-core-java; however: Package libjackson2-core-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-databind-java; however: Package libjackson2-databind-java is not installed. pbuilder-satisfydepends-dummy depends on libjcommander-java; however: Package libjcommander-java is not installed. pbuilder-satisfydepends-dummy depends on liblz4-java; however: Package liblz4-java is not installed. pbuilder-satisfydepends-dummy depends on libmockito-java; however: Package libmockito-java is not installed. pbuilder-satisfydepends-dummy depends on libredberry-pipe-java; however: Package libredberry-pipe-java is not installed. pbuilder-satisfydepends-dummy depends on libtrove3-java; however: Package libtrove3-java is not installed. Setting up pbuilder-satisfydepends-dummy (0.invalid.0) ... Reading package lists... Building dependency tree... Reading state information... Initializing package states... Writing extended state information... Building tag database... pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) The following NEW packages will be installed: adwaita-icon-theme{a} ant{a} ant-optional{a} antlr{a} at-spi2-common{a} autoconf{a} automake{a} autopoint{a} autotools-dev{a} binfmt-support{a} bnd{a} bsdextrautils{a} ca-certificates{a} ca-certificates-java{a} dctrl-tools{a} debhelper{a} default-jdk{a} default-jdk-headless{a} default-jre{a} default-jre-headless{a} devscripts{a} dh-autoreconf{a} dh-strip-nondeterminism{a} dirmngr{a} dwz{a} fastjar{a} file{a} fontconfig{a} fontconfig-config{a} fonts-dejavu-core{a} fonts-dejavu-mono{a} gettext{a} gettext-base{a} gnupg{a} gnupg-l10n{a} gnupg-utils{a} gpg{a} gpg-agent{a} gpg-wks-client{a} gpg-wks-server{a} gpgconf{a} gpgsm{a} gradle{a} gradle-debian-helper{a} groff-base{a} groovy{a} gtk-update-icon-cache{a} hicolor-icon-theme{a} intltool-debian{a} ivy{a} jarwrapper{a} java-common{a} java-wrappers{a} javahelper{a} junit4{a} libantlr-java{a} libaopalliance-java{a} libapache-pom-java{a} libarchive-zip-perl{a} libasm-java{a} libasound2-data{a} libasound2t64{a} libassuan0{a} libatinject-jsr330-api-java{a} libatk1.0-0t64{a} libavahi-client3{a} libavahi-common-data{a} libavahi-common3{a} libb-hooks-op-check-perl{a} libbcel-java{a} libbcpg-java{a} libbcprov-java{a} libbrotli1{a} libbsd0{a} libbsf-java{a} libbsh-java{a} libbyte-buddy-java{a} libcairo2{a} libcdi-api-java{a} libclass-method-modifiers-perl{a} libclass-xsaccessor-perl{a} libclone-perl{a} libcom-err2{a} libcommons-cli-java{a} libcommons-codec-java{a} libcommons-collections3-java{a} libcommons-compress-java{a} libcommons-io-java{a} libcommons-lang-java{a} libcommons-lang3-java{a} libcommons-logging-java{a} libcommons-math3-java{a} libcommons-parent-java{a} libcups2t64{a} libdatrie1{a} libdbus-1-3{a} libdd-plist-java{a} libdebhelper-perl{a} libdeflate0{a} libdevel-callchecker-perl{a} libdom4j-java{a} libdrm-amdgpu1{a} libdrm-common{a} libdrm-nouveau2{a} libdrm-radeon1{a} libdrm2{a} libdynaloader-functions-perl{a} libeclipse-jdt-annotation-java{a} libedit2{a} libel-api-java{a} libelf1t64{a} libencode-locale-perl{a} liberror-prone-java{a} libexpat1{a} libfelix-framework-java{a} libfelix-gogo-runtime-java{a} libfelix-resolver-java{a} libfile-dirlist-perl{a} libfile-homedir-perl{a} libfile-listing-perl{a} libfile-stripnondeterminism-perl{a} libfile-touch-perl{a} libfile-which-perl{a} libfindbugs-java{a} libfontconfig1{a} libfreetype6{a} libfribidi0{a} libgdk-pixbuf-2.0-0{a} libgdk-pixbuf2.0-common{a} libgeronimo-annotation-1.3-spec-java{a} libgeronimo-interceptor-3.0-spec-java{a} libgif7{a} libgl1{a} libgl1-mesa-dri{a} libglapi-mesa{a} libglib2.0-0t64{a} libglvnd0{a} libglx-mesa0{a} libglx0{a} libgoogle-gson-java{a} libgradle-core-java{a} libgradle-plugins-java{a} libgraphite2-3{a} libgssapi-krb5-2{a} libgtk2.0-0t64{a} libgtk2.0-common{a} libguava-java{a} libguice-java{a} libhamcrest-java{a} libharfbuzz0b{a} libhawtjni-runtime-java{a} libhtml-parser-perl{a} libhtml-tagset-perl{a} libhtml-tree-perl{a} libhttp-cookies-perl{a} libhttp-date-perl{a} libhttp-message-perl{a} libhttp-negotiate-perl{a} libhttpclient-java{a} libhttpcore-java{a} libicu72{a} libimport-into-perl{a} libio-html-perl{a} libio-pty-perl{a} libio-socket-ssl-perl{a} libipc-run-perl{a} libjackson2-annotations-java{a} libjackson2-core-java{a} libjackson2-databind-java{a} libjansi-java{a} libjansi-native-java{a} libjansi1-java{a} libjarjar-java{a} libjatl-java{a} libjavaewah-java{a} libjaxen-java{a} libjbig0{a} libjcifs-java{a} libjcip-annotations-java{a} libjcommander-java{a} libjetty9-java{a} libjformatstring-java{a} libjgit-java{a} libjline2-java{a} libjna-java{a} libjna-jni{a} libjpeg62-turbo{a} libjs-jquery{a} libjsch-java{a} libjsoup-java{a} libjsp-api-java{a} libjsr305-java{a} libjzlib-java{a} libk5crypto3{a} libkeyutils1{a} libkrb5-3{a} libkrb5support0{a} libkryo-java{a} libksba8{a} liblcms2-2{a} libldap-2.5-0{a} liblerc4{a} libllvm17t64{a} liblogback-java{a} liblwp-mediatypes-perl{a} liblwp-protocol-https-perl{a} liblz4-java{a} liblz4-jni{a} libmagic-mgc{a} libmagic1t64{a} libmaven-parent-java{a} libmaven-resolver-java{a} libmaven-shared-utils-java{a} libmaven3-core-java{a} libminlog-java{a} libmockito-java{a} libmodule-runtime-perl{a} libmoo-perl{a} libnative-platform-java{a} libnative-platform-jni{a} libnekohtml-java{a} libnet-http-perl{a} libnet-ssleay-perl{a} libnpth0t64{a} libnspr4{a} libnss3{a} libobjenesis-java{a} libosgi-annotation-java{a} libosgi-compendium-java{a} libosgi-core-java{a} libpango-1.0-0{a} libpangocairo-1.0-0{a} libpangoft2-1.0-0{a} libparams-classify-perl{a} libpcsclite1{a} libpipeline1{a} libpixman-1-0{a} libplexus-cipher-java{a} libplexus-classworlds-java{a} libplexus-component-annotations-java{a} libplexus-container-default-java{a} libplexus-interpolation-java{a} libplexus-sec-dispatcher-java{a} libplexus-utils2-java{a} libpng16-16t64{a} libpolyglot-maven-java{a} libpython3-stdlib{a} libpython3.11-minimal{a} libpython3.11-stdlib{a} libqdox-java{a} libreadline8t64{a} libredberry-pipe-java{a} libreflectasm-java{a} librhino-java{a} librole-tiny-perl{a} libsasl2-2{a} libsasl2-modules-db{a} libsensors-config{a} libsensors5{a} libservlet-api-java{a} libsharpyuv0{a} libsimple-http-java{a} libsisu-inject-java{a} libsisu-plexus-java{a} libslf4j-java{a} libsub-override-perl{a} libsub-quote-perl{a} libthai-data{a} libthai0{a} libtiff6{a} libtimedate-perl{a} libtool{a} libtrove3-java{a} libtry-tiny-perl{a} libuchardet0{a} liburi-perl{a} libvulkan1{a} libwagon-file-java{a} libwagon-http-java{a} libwagon-provider-api-java{a} libwebp7{a} libwebsocket-api-java{a} libwww-perl{a} libwww-robotrules-perl{a} libx11-6{a} libx11-data{a} libx11-xcb1{a} libxau6{a} libxbean-reflect-java{a} libxcb-dri2-0{a} libxcb-dri3-0{a} libxcb-glx0{a} libxcb-present0{a} libxcb-randr0{a} libxcb-render0{a} libxcb-shm0{a} libxcb-sync1{a} libxcb-xfixes0{a} libxcb1{a} libxcomposite1{a} libxcursor1{a} libxdamage1{a} libxdmcp6{a} libxerces2-java{a} libxext6{a} libxfixes3{a} libxi6{a} libxinerama1{a} libxml-commons-external-java{a} libxml-commons-resolver1.1-java{a} libxml2{a} libxpp3-java{a} libxrandr2{a} libxrender1{a} libxshmfence1{a} libxstream-java{a} libxtst6{a} libxxf86vm1{a} libxz-java{a} libyaml-snake-java{a} libz3-4{a} m4{a} man-db{a} maven-repo-helper{a} media-types{a} netbase{a} openjdk-17-jdk{a} openjdk-17-jdk-headless{a} openjdk-17-jre{a} openjdk-17-jre-headless{a} openssl{a} patchutils{a} perl-openssl-defaults{a} pinentry-curses{a} po-debconf{a} python3{a} python3-minimal{a} python3.11{a} python3.11-minimal{a} readline-common{a} sensible-utils{a} shared-mime-info{a} testng{a} tzdata{a} unzip{a} wdiff{a} x11-common{a} The following packages are RECOMMENDED but will NOT be installed: alsa-topology-conf alsa-ucm-conf curl dbus debian-keyring dput dput-ng dupload equivs fonts-dejavu-extra javascript-common krb5-locales libarchive-cpio-perl libatk-wrapper-java-jni libbindex-java libdata-dump-perl libdistro-info-perl libgail-common libgdk-pixbuf2.0-bin libgit-wrapper-perl libgitlab-api-v4-perl libglib2.0-data libgpars-groovy-java libgtk2.0-bin libhtml-form-perl libhtml-format-perl libhttp-daemon-perl libio-compress-brotli-perl libjson-perl libldap-common liblist-compare-perl libltdl-dev libmail-sendmail-perl libmailtools-perl libnamespace-clean-perl libreflectasm-java-doc librsvg2-common libsasl2-modules libsoap-lite-perl libstring-shellquote-perl libxstring-perl libxt-dev licensecheck lintian lynx mesa-vulkan-drivers pristine-tar python3-apt python3-debian python3-magic python3-requests python3-unidiff python3-xdg strace wget xdg-user-dirs 0 packages upgraded, 347 newly installed, 0 to remove and 0 not upgraded. Need to get 300 MB of archives. After unpacking 813 MB will be used. Writing extended state information... Get: 1 http://deb.debian.org/debian trixie/main arm64 libpipeline1 arm64 1.5.7-2 [36.5 kB] Get: 2 http://deb.debian.org/debian trixie/main arm64 binfmt-support arm64 2.2.2-7 [61.4 kB] Get: 3 http://deb.debian.org/debian trixie/main arm64 libpython3.11-minimal arm64 3.11.9-1 [813 kB] Get: 4 http://deb.debian.org/debian trixie/main arm64 libexpat1 arm64 2.6.2-1 [88.7 kB] Get: 5 http://deb.debian.org/debian trixie/main arm64 python3.11-minimal arm64 3.11.9-1 [1767 kB] Get: 6 http://deb.debian.org/debian trixie/main arm64 python3-minimal arm64 3.11.8-1 [26.3 kB] Get: 7 http://deb.debian.org/debian trixie/main arm64 media-types all 10.1.0 [26.9 kB] Get: 8 http://deb.debian.org/debian trixie/main arm64 netbase all 6.4 [12.8 kB] Get: 9 http://deb.debian.org/debian trixie/main arm64 tzdata all 2024a-4 [255 kB] Get: 10 http://deb.debian.org/debian trixie/main arm64 readline-common all 8.2-4 [69.3 kB] Get: 11 http://deb.debian.org/debian trixie/main arm64 libreadline8t64 arm64 8.2-4 [157 kB] Get: 12 http://deb.debian.org/debian trixie/main arm64 libpython3.11-stdlib arm64 3.11.9-1 [1775 kB] Get: 13 http://deb.debian.org/debian trixie/main arm64 python3.11 arm64 3.11.9-1 [602 kB] Get: 14 http://deb.debian.org/debian trixie/main arm64 libpython3-stdlib arm64 3.11.8-1 [9332 B] Get: 15 http://deb.debian.org/debian trixie/main arm64 python3 arm64 3.11.8-1 [27.4 kB] Get: 16 http://deb.debian.org/debian trixie/main arm64 sensible-utils all 0.0.22 [22.4 kB] Get: 17 http://deb.debian.org/debian trixie/main arm64 openssl arm64 3.2.1-3 [1324 kB] Get: 18 http://deb.debian.org/debian trixie/main arm64 ca-certificates all 20240203 [158 kB] Get: 19 http://deb.debian.org/debian trixie/main arm64 libmagic-mgc arm64 1:5.45-3 [314 kB] Get: 20 http://deb.debian.org/debian trixie/main arm64 libmagic1t64 arm64 1:5.45-3 [100 kB] Get: 21 http://deb.debian.org/debian trixie/main arm64 file arm64 1:5.45-3 [43.0 kB] Get: 22 http://deb.debian.org/debian trixie/main arm64 gettext-base arm64 0.21-14+b1 [160 kB] Get: 23 http://deb.debian.org/debian trixie/main arm64 libuchardet0 arm64 0.0.8-1+b1 [69.0 kB] Get: 24 http://deb.debian.org/debian trixie/main arm64 groff-base arm64 1.23.0-4 [1130 kB] Get: 25 http://deb.debian.org/debian trixie/main arm64 bsdextrautils arm64 2.40-8 [93.0 kB] Get: 26 http://deb.debian.org/debian trixie/main arm64 man-db arm64 2.12.1-1 [1394 kB] Get: 27 http://deb.debian.org/debian trixie/main arm64 libgdk-pixbuf2.0-common all 2.42.10+dfsg-3 [307 kB] Get: 28 http://deb.debian.org/debian trixie/main arm64 libglib2.0-0t64 arm64 2.80.1-1 [1393 kB] Get: 29 http://deb.debian.org/debian trixie/main arm64 libicu72 arm64 72.1-4+b1 [9224 kB] Get: 30 http://deb.debian.org/debian trixie/main arm64 libxml2 arm64 2.9.14+dfsg-1.3+b3 [624 kB] Get: 31 http://deb.debian.org/debian trixie/main arm64 shared-mime-info arm64 2.4-4 [755 kB] Get: 32 http://deb.debian.org/debian trixie/main arm64 libjpeg62-turbo arm64 1:2.1.5-3 [172 kB] Get: 33 http://deb.debian.org/debian trixie/main arm64 libpng16-16t64 arm64 1.6.43-5 [272 kB] Get: 34 http://deb.debian.org/debian trixie/main arm64 libdeflate0 arm64 1.20-1 [41.5 kB] Get: 35 http://deb.debian.org/debian trixie/main arm64 libjbig0 arm64 2.1-6.1+b1 [30.4 kB] Get: 36 http://deb.debian.org/debian trixie/main arm64 liblerc4 arm64 4.0.0+ds-4+b1 [142 kB] Get: 37 http://deb.debian.org/debian trixie/main arm64 libsharpyuv0 arm64 1.3.2-0.4+b1 [107 kB] Get: 38 http://deb.debian.org/debian trixie/main arm64 libwebp7 arm64 1.3.2-0.4+b1 [263 kB] Get: 39 http://deb.debian.org/debian trixie/main arm64 libtiff6 arm64 4.5.1+git230720-4 [307 kB] Get: 40 http://deb.debian.org/debian trixie/main arm64 libgdk-pixbuf-2.0-0 arm64 2.42.10+dfsg-3+b3 [130 kB] Get: 41 http://deb.debian.org/debian trixie/main arm64 gtk-update-icon-cache arm64 3.24.41-4 [46.2 kB] Get: 42 http://deb.debian.org/debian trixie/main arm64 hicolor-icon-theme all 0.17-2 [11.4 kB] Get: 43 http://deb.debian.org/debian trixie/main arm64 adwaita-icon-theme all 46.0-1 [614 kB] Get: 44 http://deb.debian.org/debian trixie/main arm64 ca-certificates-java all 20240118 [11.6 kB] Get: 45 http://deb.debian.org/debian trixie/main arm64 java-common all 0.75 [6640 B] Get: 46 http://deb.debian.org/debian trixie/main arm64 liblcms2-2 arm64 2.14-2+b1 [144 kB] Get: 47 http://deb.debian.org/debian trixie/main arm64 libnspr4 arm64 2:4.35-1.1+b1 [101 kB] Get: 48 http://deb.debian.org/debian trixie/main arm64 libnss3 arm64 2:3.99-1 [1293 kB] Get: 49 http://deb.debian.org/debian trixie/main arm64 libpcsclite1 arm64 2.0.3-1 [50.3 kB] Get: 50 http://deb.debian.org/debian trixie/main arm64 openjdk-17-jre-headless arm64 17.0.11+9-1 [42.8 MB] Get: 51 http://deb.debian.org/debian trixie/main arm64 default-jre-headless arm64 2:1.17-75 [3068 B] Get: 52 http://deb.debian.org/debian trixie/main arm64 ant all 1.10.14-1 [2162 kB] Get: 53 http://deb.debian.org/debian trixie/main arm64 ant-optional all 1.10.14-1 [455 kB] Get: 54 http://deb.debian.org/debian trixie/main arm64 libantlr-java all 2.7.7+dfsg-13 [458 kB] Get: 55 http://deb.debian.org/debian trixie/main arm64 antlr all 2.7.7+dfsg-13 [8272 B] Get: 56 http://deb.debian.org/debian trixie/main arm64 at-spi2-common all 2.52.0-1 [166 kB] Get: 57 http://deb.debian.org/debian trixie/main arm64 m4 arm64 1.4.19-4 [277 kB] Get: 58 http://deb.debian.org/debian trixie/main arm64 autoconf all 2.71-3 [332 kB] Get: 59 http://deb.debian.org/debian trixie/main arm64 autotools-dev all 20220109.1 [51.6 kB] Get: 60 http://deb.debian.org/debian trixie/main arm64 automake all 1:1.16.5-1.3 [823 kB] Get: 61 http://deb.debian.org/debian trixie/main arm64 autopoint all 0.21-14 [496 kB] Get: 62 http://deb.debian.org/debian trixie/main arm64 unzip arm64 6.0-28 [157 kB] Get: 63 http://deb.debian.org/debian trixie/main arm64 java-wrappers all 0.4 [8916 B] Get: 64 http://deb.debian.org/debian trixie/main arm64 libhamcrest-java all 2.2-2 [121 kB] Get: 65 http://deb.debian.org/debian trixie/main arm64 junit4 all 4.13.2-4 [349 kB] Get: 66 http://deb.debian.org/debian trixie/main arm64 libfelix-framework-java all 4.6.1-2.1 [569 kB] Get: 67 http://deb.debian.org/debian trixie/main arm64 libfelix-gogo-runtime-java all 0.16.2-1.1 [114 kB] Get: 68 http://deb.debian.org/debian trixie/main arm64 libosgi-annotation-java all 8.1.0-1 [9436 B] Get: 69 http://deb.debian.org/debian trixie/main arm64 libosgi-core-java all 8.0.0-2 [182 kB] Get: 70 http://deb.debian.org/debian trixie/main arm64 libfelix-resolver-java all 1.16.0-1 [180 kB] Get: 71 http://deb.debian.org/debian trixie/main arm64 libhawtjni-runtime-java all 1.18-1 [36.3 kB] Get: 72 http://deb.debian.org/debian trixie/main arm64 libjansi-native-java all 1.8-2 [26.0 kB] Get: 73 http://deb.debian.org/debian trixie/main arm64 libjansi1-java all 1.18-3 [66.5 kB] Get: 74 http://deb.debian.org/debian trixie/main arm64 libjline2-java all 2.14.6-5 [151 kB] Get: 75 http://deb.debian.org/debian trixie/main arm64 libosgi-compendium-java all 7.0.0-1 [477 kB] Get: 76 http://deb.debian.org/debian trixie/main arm64 libslf4j-java all 1.7.32-1 [144 kB] Get: 77 http://deb.debian.org/debian trixie/main arm64 libxz-java all 1.9-1 [143 kB] Get: 78 http://deb.debian.org/debian trixie/main arm64 libyaml-snake-java all 1.33-2 [321 kB] Get: 79 http://deb.debian.org/debian trixie/main arm64 bnd all 5.0.1-5 [10.1 MB] Get: 80 http://deb.debian.org/debian trixie/main arm64 dctrl-tools arm64 2.24-3 [101 kB] Get: 81 http://deb.debian.org/debian trixie/main arm64 libdebhelper-perl all 13.15.3 [88.0 kB] Get: 82 http://deb.debian.org/debian trixie/main arm64 libtool all 2.4.7-7 [517 kB] Get: 83 http://deb.debian.org/debian trixie/main arm64 dh-autoreconf all 20 [17.1 kB] Get: 84 http://deb.debian.org/debian trixie/main arm64 libarchive-zip-perl all 1.68-1 [104 kB] Get: 85 http://deb.debian.org/debian trixie/main arm64 libsub-override-perl all 0.10-1 [10.6 kB] Get: 86 http://deb.debian.org/debian trixie/main arm64 libfile-stripnondeterminism-perl all 1.13.1-1 [19.4 kB] Get: 87 http://deb.debian.org/debian trixie/main arm64 dh-strip-nondeterminism all 1.13.1-1 [8620 B] Get: 88 http://deb.debian.org/debian trixie/main arm64 libelf1t64 arm64 0.191-1+b1 [187 kB] Get: 89 http://deb.debian.org/debian trixie/main arm64 dwz arm64 0.15-1+b1 [102 kB] Get: 90 http://deb.debian.org/debian trixie/main arm64 gettext arm64 0.21-14+b1 [1249 kB] Get: 91 http://deb.debian.org/debian trixie/main arm64 intltool-debian all 0.35.0+20060710.6 [22.9 kB] Get: 92 http://deb.debian.org/debian trixie/main arm64 po-debconf all 1.0.21+nmu1 [248 kB] Get: 93 http://deb.debian.org/debian trixie/main arm64 debhelper all 13.15.3 [901 kB] Get: 94 http://deb.debian.org/debian trixie/main arm64 libgtk2.0-common all 2.24.33-4 [2661 kB] Get: 95 http://deb.debian.org/debian trixie/main arm64 libatk1.0-0t64 arm64 2.52.0-1 [49.2 kB] Get: 96 http://deb.debian.org/debian trixie/main arm64 libbrotli1 arm64 1.1.0-2+b3 [295 kB] Get: 97 http://deb.debian.org/debian trixie/main arm64 libfreetype6 arm64 2.13.2+dfsg-1+b4 [408 kB] Get: 98 http://deb.debian.org/debian trixie/main arm64 fonts-dejavu-mono all 2.37-8 [489 kB] Get: 99 http://deb.debian.org/debian trixie/main arm64 fonts-dejavu-core all 2.37-8 [840 kB] Get: 100 http://deb.debian.org/debian trixie/main arm64 fontconfig-config arm64 2.15.0-1.1 [317 kB] Get: 101 http://deb.debian.org/debian trixie/main arm64 libfontconfig1 arm64 2.15.0-1.1 [385 kB] Get: 102 http://deb.debian.org/debian trixie/main arm64 libpixman-1-0 arm64 0.42.2-1+b1 [477 kB] Get: 103 http://deb.debian.org/debian trixie/main arm64 libxau6 arm64 1:1.0.9-1+b1 [18.1 kB] Get: 104 http://deb.debian.org/debian trixie/main arm64 libbsd0 arm64 0.12.2-1 [129 kB] Get: 105 http://deb.debian.org/debian trixie/main arm64 libxdmcp6 arm64 1:1.1.2-3+b1 [24.3 kB] Get: 106 http://deb.debian.org/debian trixie/main arm64 libxcb1 arm64 1.15-1 [143 kB] Get: 107 http://deb.debian.org/debian trixie/main arm64 libx11-data all 2:1.8.7-1 [328 kB] Get: 108 http://deb.debian.org/debian trixie/main arm64 libx11-6 arm64 2:1.8.7-1+b1 [775 kB] Get: 109 http://deb.debian.org/debian trixie/main arm64 libxcb-render0 arm64 1.15-1 [115 kB] Get: 110 http://deb.debian.org/debian trixie/main arm64 libxcb-shm0 arm64 1.15-1 [106 kB] Get: 111 http://deb.debian.org/debian trixie/main arm64 libxext6 arm64 2:1.3.4-1+b1 [51.7 kB] Get: 112 http://deb.debian.org/debian trixie/main arm64 libxrender1 arm64 1:0.9.10-1.1+b1 [27.0 kB] Get: 113 http://deb.debian.org/debian trixie/main arm64 libcairo2 arm64 1.18.0-3+b1 [478 kB] Get: 114 http://deb.debian.org/debian trixie/main arm64 libavahi-common-data arm64 0.8-13+b2 [112 kB] Get: 115 http://deb.debian.org/debian trixie/main arm64 libavahi-common3 arm64 0.8-13+b2 [42.4 kB] Get: 116 http://deb.debian.org/debian trixie/main arm64 libdbus-1-3 arm64 1.14.10-4+b1 [195 kB] Get: 117 http://deb.debian.org/debian trixie/main arm64 libavahi-client3 arm64 0.8-13+b2 [45.7 kB] Get: 118 http://deb.debian.org/debian trixie/main arm64 libkrb5support0 arm64 1.20.1-6+b1 [33.0 kB] Get: 119 http://deb.debian.org/debian trixie/main arm64 libcom-err2 arm64 1.47.1~rc2-1 [22.5 kB] Get: 120 http://deb.debian.org/debian trixie/main arm64 libk5crypto3 arm64 1.20.1-6+b1 [80.5 kB] Get: 121 http://deb.debian.org/debian trixie/main arm64 libkeyutils1 arm64 1.6.3-3 [9112 B] Get: 122 http://deb.debian.org/debian trixie/main arm64 libkrb5-3 arm64 1.20.1-6+b1 [315 kB] Get: 123 http://deb.debian.org/debian trixie/main arm64 libgssapi-krb5-2 arm64 1.20.1-6+b1 [124 kB] Get: 124 http://deb.debian.org/debian trixie/main arm64 libcups2t64 arm64 2.4.7-1.2+b1 [230 kB] Get: 125 http://deb.debian.org/debian trixie/main arm64 fontconfig arm64 2.15.0-1.1 [462 kB] Get: 126 http://deb.debian.org/debian trixie/main arm64 libfribidi0 arm64 1.0.13-3+b1 [71.3 kB] Get: 127 http://deb.debian.org/debian trixie/main arm64 libgraphite2-3 arm64 1.3.14-2 [69.2 kB] Get: 128 http://deb.debian.org/debian trixie/main arm64 libharfbuzz0b arm64 8.3.0-2+b1 [2178 kB] Get: 129 http://deb.debian.org/debian trixie/main arm64 libthai-data all 0.1.29-2 [168 kB] Get: 130 http://deb.debian.org/debian trixie/main arm64 libdatrie1 arm64 0.2.13-3 [37.2 kB] Get: 131 http://deb.debian.org/debian trixie/main arm64 libthai0 arm64 0.1.29-2 [48.0 kB] Get: 132 http://deb.debian.org/debian trixie/main arm64 libpango-1.0-0 arm64 1.52.2+ds-1 [206 kB] Get: 133 http://deb.debian.org/debian trixie/main arm64 libpangoft2-1.0-0 arm64 1.52.2+ds-1 [45.5 kB] Get: 134 http://deb.debian.org/debian trixie/main arm64 libpangocairo-1.0-0 arm64 1.52.2+ds-1 [33.0 kB] Get: 135 http://deb.debian.org/debian trixie/main arm64 libxcomposite1 arm64 1:0.4.5-1+b1 [15.0 kB] Get: 136 http://deb.debian.org/debian trixie/main arm64 libxfixes3 arm64 1:6.0.0-2+b1 [20.5 kB] Get: 137 http://deb.debian.org/debian trixie/main arm64 libxcursor1 arm64 1:1.2.1-1+b1 [35.8 kB] Get: 138 http://deb.debian.org/debian trixie/main arm64 libxdamage1 arm64 1:1.1.6-1+b1 [15.6 kB] Get: 139 http://deb.debian.org/debian trixie/main arm64 libxi6 arm64 2:1.8.1-1 [77.5 kB] Get: 140 http://deb.debian.org/debian trixie/main arm64 libxinerama1 arm64 2:1.1.4-3+b1 [16.0 kB] Get: 141 http://deb.debian.org/debian trixie/main arm64 libxrandr2 arm64 2:1.5.4-1 [35.7 kB] Get: 142 http://deb.debian.org/debian trixie/main arm64 libgtk2.0-0t64 arm64 2.24.33-4 [1663 kB] Get: 143 http://deb.debian.org/debian trixie/main arm64 libglvnd0 arm64 1.7.0-1+b1 [41.7 kB] Get: 144 http://deb.debian.org/debian trixie/main arm64 libdrm-common all 2.4.120-2 [7688 B] Get: 145 http://deb.debian.org/debian trixie/main arm64 libdrm2 arm64 2.4.120-2 [37.5 kB] Get: 146 http://deb.debian.org/debian trixie/main arm64 libglapi-mesa arm64 24.0.6-1+b1 [46.8 kB] Get: 147 http://deb.debian.org/debian trixie/main arm64 libx11-xcb1 arm64 2:1.8.7-1+b1 [232 kB] Get: 148 http://deb.debian.org/debian trixie/main arm64 libxcb-dri2-0 arm64 1.15-1 [107 kB] Get: 149 http://deb.debian.org/debian trixie/main arm64 libxcb-dri3-0 arm64 1.15-1 [107 kB] Get: 150 http://deb.debian.org/debian trixie/main arm64 libxcb-glx0 arm64 1.15-1 [123 kB] Get: 151 http://deb.debian.org/debian trixie/main arm64 libxcb-present0 arm64 1.15-1 [106 kB] Get: 152 http://deb.debian.org/debian trixie/main arm64 libxcb-randr0 arm64 1.15-1 [117 kB] Get: 153 http://deb.debian.org/debian trixie/main arm64 libxcb-sync1 arm64 1.15-1 [109 kB] Get: 154 http://deb.debian.org/debian trixie/main arm64 libxcb-xfixes0 arm64 1.15-1 [110 kB] Get: 155 http://deb.debian.org/debian trixie/main arm64 libxshmfence1 arm64 1.3-1+b1 [9080 B] Get: 156 http://deb.debian.org/debian trixie/main arm64 libxxf86vm1 arm64 1:1.1.4-1+b2 [20.1 kB] Get: 157 http://deb.debian.org/debian trixie/main arm64 libvulkan1 arm64 1.3.280.0-1 [119 kB] Get: 158 http://deb.debian.org/debian trixie/main arm64 libdrm-amdgpu1 arm64 2.4.120-2 [21.0 kB] Get: 159 http://deb.debian.org/debian trixie/main arm64 libdrm-nouveau2 arm64 2.4.120-2 [18.7 kB] Get: 160 http://deb.debian.org/debian trixie/main arm64 libdrm-radeon1 arm64 2.4.120-2 [21.1 kB] Get: 161 http://deb.debian.org/debian trixie/main arm64 libedit2 arm64 3.1-20230828-1+b1 [89.1 kB] Get: 162 http://deb.debian.org/debian trixie/main arm64 libz3-4 arm64 4.8.12-3.1+b2 [6508 kB] Get: 163 http://deb.debian.org/debian trixie/main arm64 libllvm17t64 arm64 1:17.0.6-12 [21.3 MB] Get: 164 http://deb.debian.org/debian trixie/main arm64 libsensors-config all 1:3.6.0-9 [14.6 kB] Get: 165 http://deb.debian.org/debian trixie/main arm64 libsensors5 arm64 1:3.6.0-9 [33.9 kB] Get: 166 http://deb.debian.org/debian trixie/main arm64 libgl1-mesa-dri arm64 24.0.6-1+b1 [7020 kB] Get: 167 http://deb.debian.org/debian trixie/main arm64 libglx-mesa0 arm64 24.0.6-1+b1 [150 kB] Get: 168 http://deb.debian.org/debian trixie/main arm64 libglx0 arm64 1.7.0-1+b1 [31.0 kB] Get: 169 http://deb.debian.org/debian trixie/main arm64 libgl1 arm64 1.7.0-1+b1 [90.9 kB] Get: 170 http://deb.debian.org/debian trixie/main arm64 libasound2-data all 1.2.11-1 [20.9 kB] Get: 171 http://deb.debian.org/debian trixie/main arm64 libasound2t64 arm64 1.2.11-1+b1 [334 kB] Get: 172 http://deb.debian.org/debian trixie/main arm64 libgif7 arm64 5.2.2-1 [43.7 kB] Get: 173 http://deb.debian.org/debian trixie/main arm64 x11-common all 1:7.7+23 [252 kB] Get: 174 http://deb.debian.org/debian trixie/main arm64 libxtst6 arm64 2:1.2.3-1.1+b1 [25.9 kB] Get: 175 http://deb.debian.org/debian trixie/main arm64 openjdk-17-jre arm64 17.0.11+9-1 [174 kB] Get: 176 http://deb.debian.org/debian trixie/main arm64 default-jre arm64 2:1.17-75 [1056 B] Get: 177 http://deb.debian.org/debian trixie/main arm64 openjdk-17-jdk-headless arm64 17.0.11+9-1 [70.6 MB] Get: 178 http://deb.debian.org/debian trixie/main arm64 default-jdk-headless arm64 2:1.17-75 [1108 B] Get: 179 http://deb.debian.org/debian trixie/main arm64 openjdk-17-jdk arm64 17.0.11+9-1 [10.4 kB] Get: 180 http://deb.debian.org/debian trixie/main arm64 default-jdk arm64 2:1.17-75 [1068 B] Get: 181 http://deb.debian.org/debian trixie/main arm64 libassuan0 arm64 2.5.6-1+b1 [48.0 kB] Get: 182 http://deb.debian.org/debian trixie/main arm64 gpgconf arm64 2.2.40-3 [558 kB] Get: 183 http://deb.debian.org/debian trixie/main arm64 libksba8 arm64 1.6.6-1 [122 kB] Get: 184 http://deb.debian.org/debian trixie/main arm64 libsasl2-modules-db arm64 2.1.28+dfsg1-6 [20.1 kB] Get: 185 http://deb.debian.org/debian trixie/main arm64 libsasl2-2 arm64 2.1.28+dfsg1-6 [55.3 kB] Get: 186 http://deb.debian.org/debian trixie/main arm64 libldap-2.5-0 arm64 2.5.17+dfsg-1 [173 kB] Get: 187 http://deb.debian.org/debian trixie/main arm64 libnpth0t64 arm64 1.6-3.1 [17.8 kB] Get: 188 http://deb.debian.org/debian trixie/main arm64 dirmngr arm64 2.2.40-3 [771 kB] Get: 189 http://deb.debian.org/debian trixie/main arm64 gnupg-l10n all 2.2.40-3 [1094 kB] Get: 190 http://deb.debian.org/debian trixie/main arm64 gnupg-utils arm64 2.2.40-3 [883 kB] Get: 191 http://deb.debian.org/debian trixie/main arm64 gpg arm64 2.2.40-3 [903 kB] Get: 192 http://deb.debian.org/debian trixie/main arm64 pinentry-curses arm64 1.2.1-3+b2 [75.9 kB] Get: 193 http://deb.debian.org/debian trixie/main arm64 gpg-agent arm64 2.2.40-3 [675 kB] Get: 194 http://deb.debian.org/debian trixie/main arm64 gpg-wks-client arm64 2.2.40-3 [533 kB] Get: 195 http://deb.debian.org/debian trixie/main arm64 gpg-wks-server arm64 2.2.40-3 [525 kB] Get: 196 http://deb.debian.org/debian trixie/main arm64 gpgsm arm64 2.2.40-3 [650 kB] Get: 197 http://deb.debian.org/debian trixie/main arm64 gnupg all 2.2.40-3 [847 kB] Get: 198 http://deb.debian.org/debian trixie/main arm64 libfile-dirlist-perl all 0.05-3 [7600 B] Get: 199 http://deb.debian.org/debian trixie/main arm64 libfile-which-perl all 1.27-2 [15.1 kB] Get: 200 http://deb.debian.org/debian trixie/main arm64 libfile-homedir-perl all 1.006-2 [42.4 kB] Get: 201 http://deb.debian.org/debian trixie/main arm64 libfile-touch-perl all 0.12-2 [8816 B] Get: 202 http://deb.debian.org/debian trixie/main arm64 libio-pty-perl arm64 1:1.20-1+b1 [34.0 kB] Get: 203 http://deb.debian.org/debian trixie/main arm64 libipc-run-perl all 20231003.0-2 [101 kB] Get: 204 http://deb.debian.org/debian trixie/main arm64 libclass-method-modifiers-perl all 2.15-1 [18.0 kB] Get: 205 http://deb.debian.org/debian trixie/main arm64 libclass-xsaccessor-perl arm64 1.19-4+b3 [35.2 kB] Get: 206 http://deb.debian.org/debian trixie/main arm64 libb-hooks-op-check-perl arm64 0.22-3+b1 [10.6 kB] Get: 207 http://deb.debian.org/debian trixie/main arm64 libdynaloader-functions-perl all 0.003-3 [12.7 kB] Get: 208 http://deb.debian.org/debian trixie/main arm64 libdevel-callchecker-perl arm64 0.009-1 [16.0 kB] Get: 209 http://deb.debian.org/debian trixie/main arm64 libparams-classify-perl arm64 0.015-2+b3 [22.3 kB] Get: 210 http://deb.debian.org/debian trixie/main arm64 libmodule-runtime-perl all 0.016-2 [19.6 kB] Get: 211 http://deb.debian.org/debian trixie/main arm64 libimport-into-perl all 1.002005-2 [11.3 kB] Get: 212 http://deb.debian.org/debian trixie/main arm64 librole-tiny-perl all 2.002004-1 [21.4 kB] Get: 213 http://deb.debian.org/debian trixie/main arm64 libsub-quote-perl all 2.006008-1 [21.8 kB] Get: 214 http://deb.debian.org/debian trixie/main arm64 libmoo-perl all 2.005005-1 [58.0 kB] Get: 215 http://deb.debian.org/debian trixie/main arm64 libencode-locale-perl all 1.05-3 [12.9 kB] Get: 216 http://deb.debian.org/debian trixie/main arm64 libtimedate-perl all 2.3300-2 [39.3 kB] Get: 217 http://deb.debian.org/debian trixie/main arm64 libhttp-date-perl all 6.06-1 [10.7 kB] Get: 218 http://deb.debian.org/debian trixie/main arm64 libfile-listing-perl all 6.16-1 [12.4 kB] Get: 219 http://deb.debian.org/debian trixie/main arm64 libhtml-tagset-perl all 3.24-1 [14.7 kB] Get: 220 http://deb.debian.org/debian trixie/main arm64 liburi-perl all 5.28-1 [98.6 kB] Get: 221 http://deb.debian.org/debian trixie/main arm64 libhtml-parser-perl arm64 3.82-1 [96.9 kB] Get: 222 http://deb.debian.org/debian trixie/main arm64 libhtml-tree-perl all 5.07-3 [211 kB] Get: 223 http://deb.debian.org/debian trixie/main arm64 libclone-perl arm64 0.46-1+b2 [13.6 kB] Get: 224 http://deb.debian.org/debian trixie/main arm64 libio-html-perl all 1.004-3 [16.2 kB] Get: 225 http://deb.debian.org/debian trixie/main arm64 liblwp-mediatypes-perl all 6.04-2 [20.2 kB] Get: 226 http://deb.debian.org/debian trixie/main arm64 libhttp-message-perl all 6.45-1 [82.0 kB] Get: 227 http://deb.debian.org/debian trixie/main arm64 libhttp-cookies-perl all 6.11-1 [19.1 kB] Get: 228 http://deb.debian.org/debian trixie/main arm64 libhttp-negotiate-perl all 6.01-2 [13.1 kB] Get: 229 http://deb.debian.org/debian trixie/main arm64 perl-openssl-defaults arm64 7+b2 [6712 B] Get: 230 http://deb.debian.org/debian trixie/main arm64 libnet-ssleay-perl arm64 1.94-1+b1 [328 kB] Get: 231 http://deb.debian.org/debian trixie/main arm64 libio-socket-ssl-perl all 2.085-1 [218 kB] Get: 232 http://deb.debian.org/debian trixie/main arm64 libnet-http-perl all 6.23-1 [23.9 kB] Get: 233 http://deb.debian.org/debian trixie/main arm64 liblwp-protocol-https-perl all 6.14-1 [10.8 kB] Get: 234 http://deb.debian.org/debian trixie/main arm64 libtry-tiny-perl all 0.31-2 [22.6 kB] Get: 235 http://deb.debian.org/debian trixie/main arm64 libwww-robotrules-perl all 6.02-1 [12.9 kB] Get: 236 http://deb.debian.org/debian trixie/main arm64 libwww-perl all 6.77-1 [183 kB] Get: 237 http://deb.debian.org/debian trixie/main arm64 patchutils arm64 0.4.2-1 [73.5 kB] Get: 238 http://deb.debian.org/debian trixie/main arm64 wdiff arm64 1.2.2-6 [118 kB] Get: 239 http://deb.debian.org/debian trixie/main arm64 devscripts all 2.23.7 [1068 kB] Get: 240 http://deb.debian.org/debian trixie/main arm64 fastjar arm64 2:0.98-7 [75.5 kB] Get: 241 http://deb.debian.org/debian trixie/main arm64 ivy all 2.5.2-1 [1295 kB] Get: 242 http://deb.debian.org/debian trixie/main arm64 libasm-java all 9.7-1 [394 kB] Get: 243 http://deb.debian.org/debian trixie/main arm64 libbsf-java all 1:2.4.0-8 [76.3 kB] Get: 244 http://deb.debian.org/debian trixie/main arm64 libcommons-cli-java all 1.6.0-1 [60.4 kB] Get: 245 http://deb.debian.org/debian trixie/main arm64 libapache-pom-java all 29-2 [5276 B] Get: 246 http://deb.debian.org/debian trixie/main arm64 libcommons-parent-java all 56-1 [10.8 kB] Get: 247 http://deb.debian.org/debian trixie/main arm64 libcommons-logging-java all 1.3.0-1 [68.6 kB] Get: 248 http://deb.debian.org/debian trixie/main arm64 libjansi-java all 2.4.1-2 [100 kB] Get: 249 http://deb.debian.org/debian trixie/main arm64 libjsp-api-java all 2.3.4-3 [53.7 kB] Get: 250 http://deb.debian.org/debian trixie/main arm64 libqdox-java all 1.12.1-3 [172 kB] Get: 251 http://deb.debian.org/debian trixie/main arm64 libservlet-api-java all 4.0.1-2 [81.0 kB] Get: 252 http://deb.debian.org/debian trixie/main arm64 libxpp3-java all 1.1.4c-3 [292 kB] Get: 253 http://deb.debian.org/debian trixie/main arm64 libxstream-java all 1.4.20-1 [565 kB] Get: 254 http://deb.debian.org/debian trixie/main arm64 groovy all 2.4.21-10 [12.8 MB] Get: 255 http://deb.debian.org/debian trixie/main arm64 libatinject-jsr330-api-java all 1.0+ds1-5 [5312 B] Get: 256 http://deb.debian.org/debian trixie/main arm64 libcommons-collections3-java all 3.2.2-3 [530 kB] Get: 257 http://deb.debian.org/debian trixie/main arm64 libcommons-compress-java all 1.25.0-1 [635 kB] Get: 258 http://deb.debian.org/debian trixie/main arm64 libcommons-io-java all 2.16.1-1 [480 kB] Get: 259 http://deb.debian.org/debian trixie/main arm64 libcommons-lang-java all 2.6-10 [273 kB] Get: 260 http://deb.debian.org/debian trixie/main arm64 liberror-prone-java all 2.18.0-1 [22.5 kB] Get: 261 http://deb.debian.org/debian trixie/main arm64 libjsr305-java all 0.1~+svn49-11 [26.9 kB] Get: 262 http://deb.debian.org/debian trixie/main arm64 libguava-java all 32.0.1-1 [2708 kB] Get: 263 http://deb.debian.org/debian trixie/main arm64 libcommons-codec-java all 1.16.0-1 [297 kB] Get: 264 http://deb.debian.org/debian trixie/main arm64 libhttpcore-java all 4.4.16-1 [636 kB] Get: 265 http://deb.debian.org/debian trixie/main arm64 libhttpclient-java all 4.5.14-1 [1247 kB] Get: 266 http://deb.debian.org/debian trixie/main arm64 libjarjar-java all 1.4+svn142-12 [205 kB] Get: 267 http://deb.debian.org/debian trixie/main arm64 libjcip-annotations-java all 20060626-6 [11.8 kB] Get: 268 http://deb.debian.org/debian trixie/main arm64 libjna-jni arm64 5.14.0-1 [61.5 kB] Get: 269 http://deb.debian.org/debian trixie/main arm64 libjna-java all 5.14.0-1 [237 kB] Get: 270 http://deb.debian.org/debian trixie/main arm64 libjzlib-java all 1.1.3-3 [79.4 kB] Get: 271 http://deb.debian.org/debian trixie/main arm64 libjsch-java all 0.1.55-1 [298 kB] Get: 272 http://deb.debian.org/debian trixie/main arm64 libminlog-java all 1.3.0-1.1 [7928 B] Get: 273 http://deb.debian.org/debian trixie/main arm64 libobjenesis-java all 3.3-3 [41.3 kB] Get: 274 http://deb.debian.org/debian trixie/main arm64 libreflectasm-java all 1.11.9+dfsg-4 [25.0 kB] Get: 275 http://deb.debian.org/debian trixie/main arm64 libkryo-java all 2.20-7 [158 kB] Get: 276 http://deb.debian.org/debian trixie/main arm64 liblogback-java all 1:1.2.11-5 [701 kB] Get: 277 http://deb.debian.org/debian trixie/main arm64 libnative-platform-jni arm64 0.14-6 [11.4 kB] Get: 278 http://deb.debian.org/debian trixie/main arm64 libnative-platform-java all 0.14-6 [69.8 kB] Get: 279 http://deb.debian.org/debian trixie/main arm64 libxml-commons-external-java all 1.4.01-6 [240 kB] Get: 280 http://deb.debian.org/debian trixie/main arm64 libxml-commons-resolver1.1-java all 1.2-11 [98.3 kB] Get: 281 http://deb.debian.org/debian trixie/main arm64 libxerces2-java all 2.12.2-1 [1440 kB] Get: 282 http://deb.debian.org/debian trixie/main arm64 libnekohtml-java all 1.9.22.noko2-0.1 [125 kB] Get: 283 http://deb.debian.org/debian trixie/main arm64 libxbean-reflect-java all 4.5-8 [133 kB] Get: 284 http://deb.debian.org/debian trixie/main arm64 libgradle-core-java all 4.4.1-20 [4293 kB] Get: 285 http://deb.debian.org/debian trixie/main arm64 libbcprov-java all 1.77-1 [5300 kB] Get: 286 http://deb.debian.org/debian trixie/main arm64 libbcpg-java all 1.77-1 [428 kB] Get: 287 http://deb.debian.org/debian trixie/main arm64 libbsh-java all 2.0b4-20 [291 kB] Get: 288 http://deb.debian.org/debian trixie/main arm64 libdd-plist-java all 1.20-1.1 [72.6 kB] Get: 289 http://deb.debian.org/debian trixie/main arm64 libjaxen-java all 1.1.6-4 [214 kB] Get: 290 http://deb.debian.org/debian trixie/main arm64 libdom4j-java all 2.1.4-1 [312 kB] Get: 291 http://deb.debian.org/debian trixie/main arm64 libbcel-java all 6.5.0-2 [634 kB] Get: 292 http://deb.debian.org/debian trixie/main arm64 libjformatstring-java all 0.10~20131207-2.1 [34.5 kB] Get: 293 http://deb.debian.org/debian trixie/main arm64 libfindbugs-java all 3.1.0~preview2-3 [3502 kB] Get: 294 http://deb.debian.org/debian trixie/main arm64 libgoogle-gson-java all 2.10.1-1 [262 kB] Get: 295 http://deb.debian.org/debian trixie/main arm64 libaopalliance-java all 20070526-7 [8572 B] Get: 296 http://deb.debian.org/debian trixie/main arm64 libguice-java all 4.2.3-2 [1435 kB] Get: 297 http://deb.debian.org/debian trixie/main arm64 libjatl-java all 0.2.3-1.1 [29.0 kB] Get: 298 http://deb.debian.org/debian trixie/main arm64 libjcifs-java all 1.3.19-2 [394 kB] Get: 299 http://deb.debian.org/debian trixie/main arm64 libeclipse-jdt-annotation-java all 2.2.700+eclipse4.26-2 [25.3 kB] Get: 300 http://deb.debian.org/debian trixie/main arm64 libjavaewah-java all 1.2.3-1 [159 kB] Get: 301 http://deb.debian.org/debian trixie/main arm64 libel-api-java all 3.0.0-3 [64.9 kB] Get: 302 http://deb.debian.org/debian trixie/main arm64 libwebsocket-api-java all 1.1-2 [40.1 kB] Get: 303 http://deb.debian.org/debian trixie/main arm64 libjetty9-java all 9.4.54-1 [2980 kB] Get: 304 http://deb.debian.org/debian trixie/main arm64 libjgit-java all 4.11.9-2 [2534 kB] Get: 305 http://deb.debian.org/debian trixie/main arm64 libjs-jquery all 3.6.1+dfsg+~3.5.14-1 [326 kB] Get: 306 http://deb.debian.org/debian trixie/main arm64 libcommons-lang3-java all 3.14.0-1 [621 kB] Get: 307 http://deb.debian.org/debian trixie/main arm64 libplexus-utils2-java all 3.4.2-1 [258 kB] Get: 308 http://deb.debian.org/debian trixie/main arm64 libwagon-provider-api-java all 3.5.3-1 [48.2 kB] Get: 309 http://deb.debian.org/debian trixie/main arm64 libmaven-resolver-java all 1.6.3-1 [548 kB] Get: 310 http://deb.debian.org/debian trixie/main arm64 libgeronimo-annotation-1.3-spec-java all 1.3-1 [11.1 kB] Get: 311 http://deb.debian.org/debian trixie/main arm64 libmaven-parent-java all 35-1 [6140 B] Get: 312 http://deb.debian.org/debian trixie/main arm64 libmaven-shared-utils-java all 3.3.4-1 [138 kB] Get: 313 http://deb.debian.org/debian trixie/main arm64 libplexus-cipher-java all 2.0-1 [14.9 kB] Get: 314 http://deb.debian.org/debian trixie/main arm64 libplexus-classworlds-java all 2.7.0-1 [50.6 kB] Get: 315 http://deb.debian.org/debian trixie/main arm64 libplexus-component-annotations-java all 2.1.1-1 [7660 B] Get: 316 http://deb.debian.org/debian trixie/main arm64 libplexus-interpolation-java all 1.26-1 [76.8 kB] Get: 317 http://deb.debian.org/debian trixie/main arm64 libplexus-sec-dispatcher-java all 2.0-3 [28.3 kB] Get: 318 http://deb.debian.org/debian trixie/main arm64 libgeronimo-interceptor-3.0-spec-java all 1.0.1-4 [8484 B] Get: 319 http://deb.debian.org/debian trixie/main arm64 libcdi-api-java all 1.2-3 [54.3 kB] Get: 320 http://deb.debian.org/debian trixie/main arm64 libsisu-inject-java all 0.3.4-2 [347 kB] Get: 321 http://deb.debian.org/debian trixie/main arm64 libsisu-plexus-java all 0.3.4-3 [181 kB] Get: 322 http://deb.debian.org/debian trixie/main arm64 libmaven3-core-java all 3.8.7-2 [1573 kB] Get: 323 http://deb.debian.org/debian trixie/main arm64 libplexus-container-default-java all 2.1.1-1 [193 kB] Get: 324 http://deb.debian.org/debian trixie/main arm64 libpolyglot-maven-java all 0.8~tobrien+git20120905-10 [74.9 kB] Get: 325 http://deb.debian.org/debian trixie/main arm64 librhino-java all 1.7.14-2.1 [1357 kB] Get: 326 http://deb.debian.org/debian trixie/main arm64 libsimple-http-java all 4.1.21-1.1 [211 kB] Get: 327 http://deb.debian.org/debian trixie/main arm64 libwagon-file-java all 3.5.3-1 [8388 B] Get: 328 http://deb.debian.org/debian trixie/main arm64 libjsoup-java all 1.15.3-1 [431 kB] Get: 329 http://deb.debian.org/debian trixie/main arm64 libwagon-http-java all 3.5.3-1 [49.5 kB] Get: 330 http://deb.debian.org/debian trixie/main arm64 libjcommander-java all 1.71-4 [73.0 kB] Get: 331 http://deb.debian.org/debian trixie/main arm64 testng all 6.9.12-4 [795 kB] Get: 332 http://deb.debian.org/debian trixie/main arm64 libgradle-plugins-java all 4.4.1-20 [5206 kB] Get: 333 http://deb.debian.org/debian trixie/main arm64 gradle all 4.4.1-20 [398 kB] Get: 334 http://deb.debian.org/debian trixie/main arm64 maven-repo-helper all 1.11 [142 kB] Get: 335 http://deb.debian.org/debian trixie/main arm64 gradle-debian-helper all 2.4 [24.5 kB] Get: 336 http://deb.debian.org/debian trixie/main arm64 jarwrapper all 0.79 [10.1 kB] Get: 337 http://deb.debian.org/debian trixie/main arm64 javahelper all 0.79 [84.6 kB] Get: 338 http://deb.debian.org/debian trixie/main arm64 libbyte-buddy-java all 1.14.13-1 [4709 kB] Get: 339 http://deb.debian.org/debian trixie/main arm64 libcommons-math3-java all 3.6.1-3 [2018 kB] Get: 340 http://deb.debian.org/debian trixie/main arm64 libjackson2-annotations-java all 2.14.0-1 [68.8 kB] Get: 341 http://deb.debian.org/debian trixie/main arm64 libjackson2-core-java all 2.14.1-1 [447 kB] Get: 342 http://deb.debian.org/debian trixie/main arm64 libjackson2-databind-java all 2.14.0-1 [1584 kB] Get: 343 http://deb.debian.org/debian trixie/main arm64 liblz4-jni arm64 1.8.0-4 [10.1 kB] Get: 344 http://deb.debian.org/debian trixie/main arm64 liblz4-java all 1.8.0-4 [116 kB] Get: 345 http://deb.debian.org/debian trixie/main arm64 libmockito-java all 2.23.0-2 [479 kB] Get: 346 http://deb.debian.org/debian trixie/main arm64 libredberry-pipe-java all 1.0.0~alpha0-3 [62.7 kB] Get: 347 http://deb.debian.org/debian trixie/main arm64 libtrove3-java all 3.0.3-5 [2146 kB] Fetched 300 MB in 5s (64.2 MB/s) debconf: delaying package configuration, since apt-utils is not installed Selecting previously unselected package libpipeline1:arm64. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19744 files and directories currently installed.) Preparing to unpack .../libpipeline1_1.5.7-2_arm64.deb ... Unpacking libpipeline1:arm64 (1.5.7-2) ... Selecting previously unselected package binfmt-support. Preparing to unpack .../binfmt-support_2.2.2-7_arm64.deb ... Unpacking binfmt-support (2.2.2-7) ... Selecting previously unselected package libpython3.11-minimal:arm64. Preparing to unpack .../libpython3.11-minimal_3.11.9-1_arm64.deb ... Unpacking libpython3.11-minimal:arm64 (3.11.9-1) ... Selecting previously unselected package libexpat1:arm64. Preparing to unpack .../libexpat1_2.6.2-1_arm64.deb ... Unpacking libexpat1:arm64 (2.6.2-1) ... Selecting previously unselected package python3.11-minimal. Preparing to unpack .../python3.11-minimal_3.11.9-1_arm64.deb ... Unpacking python3.11-minimal (3.11.9-1) ... Setting up libpython3.11-minimal:arm64 (3.11.9-1) ... Setting up libexpat1:arm64 (2.6.2-1) ... Setting up python3.11-minimal (3.11.9-1) ... Selecting previously unselected package python3-minimal. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 20083 files and directories currently installed.) Preparing to unpack .../0-python3-minimal_3.11.8-1_arm64.deb ... Unpacking python3-minimal (3.11.8-1) ... Selecting previously unselected package media-types. Preparing to unpack .../1-media-types_10.1.0_all.deb ... Unpacking media-types (10.1.0) ... Selecting previously unselected package netbase. Preparing to unpack .../2-netbase_6.4_all.deb ... Unpacking netbase (6.4) ... Selecting previously unselected package tzdata. Preparing to unpack .../3-tzdata_2024a-4_all.deb ... Unpacking tzdata (2024a-4) ... Selecting previously unselected package readline-common. Preparing to unpack .../4-readline-common_8.2-4_all.deb ... Unpacking readline-common (8.2-4) ... Selecting previously unselected package libreadline8t64:arm64. Preparing to unpack .../5-libreadline8t64_8.2-4_arm64.deb ... Adding 'diversion of /lib/aarch64-linux-gnu/libhistory.so.8 to /lib/aarch64-linux-gnu/libhistory.so.8.usr-is-merged by libreadline8t64' Adding 'diversion of /lib/aarch64-linux-gnu/libhistory.so.8.2 to /lib/aarch64-linux-gnu/libhistory.so.8.2.usr-is-merged by libreadline8t64' Adding 'diversion of /lib/aarch64-linux-gnu/libreadline.so.8 to /lib/aarch64-linux-gnu/libreadline.so.8.usr-is-merged by libreadline8t64' Adding 'diversion of /lib/aarch64-linux-gnu/libreadline.so.8.2 to /lib/aarch64-linux-gnu/libreadline.so.8.2.usr-is-merged by libreadline8t64' Unpacking libreadline8t64:arm64 (8.2-4) ... Selecting previously unselected package libpython3.11-stdlib:arm64. Preparing to unpack .../6-libpython3.11-stdlib_3.11.9-1_arm64.deb ... Unpacking libpython3.11-stdlib:arm64 (3.11.9-1) ... Selecting previously unselected package python3.11. Preparing to unpack .../7-python3.11_3.11.9-1_arm64.deb ... Unpacking python3.11 (3.11.9-1) ... Selecting previously unselected package libpython3-stdlib:arm64. Preparing to unpack .../8-libpython3-stdlib_3.11.8-1_arm64.deb ... Unpacking libpython3-stdlib:arm64 (3.11.8-1) ... Setting up python3-minimal (3.11.8-1) ... Selecting previously unselected package python3. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 21075 files and directories currently installed.) Preparing to unpack .../000-python3_3.11.8-1_arm64.deb ... Unpacking python3 (3.11.8-1) ... Selecting previously unselected package sensible-utils. Preparing to unpack .../001-sensible-utils_0.0.22_all.deb ... Unpacking sensible-utils (0.0.22) ... Selecting previously unselected package openssl. Preparing to unpack .../002-openssl_3.2.1-3_arm64.deb ... Unpacking openssl (3.2.1-3) ... Selecting previously unselected package ca-certificates. Preparing to unpack .../003-ca-certificates_20240203_all.deb ... Unpacking ca-certificates (20240203) ... Selecting previously unselected package libmagic-mgc. Preparing to unpack .../004-libmagic-mgc_1%3a5.45-3_arm64.deb ... Unpacking libmagic-mgc (1:5.45-3) ... Selecting previously unselected package libmagic1t64:arm64. Preparing to unpack .../005-libmagic1t64_1%3a5.45-3_arm64.deb ... Unpacking libmagic1t64:arm64 (1:5.45-3) ... Selecting previously unselected package file. Preparing to unpack .../006-file_1%3a5.45-3_arm64.deb ... Unpacking file (1:5.45-3) ... Selecting previously unselected package gettext-base. Preparing to unpack .../007-gettext-base_0.21-14+b1_arm64.deb ... Unpacking gettext-base (0.21-14+b1) ... Selecting previously unselected package libuchardet0:arm64. Preparing to unpack .../008-libuchardet0_0.0.8-1+b1_arm64.deb ... Unpacking libuchardet0:arm64 (0.0.8-1+b1) ... Selecting previously unselected package groff-base. Preparing to unpack .../009-groff-base_1.23.0-4_arm64.deb ... Unpacking groff-base (1.23.0-4) ... Selecting previously unselected package bsdextrautils. Preparing to unpack .../010-bsdextrautils_2.40-8_arm64.deb ... Unpacking bsdextrautils (2.40-8) ... Selecting previously unselected package man-db. Preparing to unpack .../011-man-db_2.12.1-1_arm64.deb ... Unpacking man-db (2.12.1-1) ... Selecting previously unselected package libgdk-pixbuf2.0-common. Preparing to unpack .../012-libgdk-pixbuf2.0-common_2.42.10+dfsg-3_all.deb ... Unpacking libgdk-pixbuf2.0-common (2.42.10+dfsg-3) ... Selecting previously unselected package libglib2.0-0t64:arm64. Preparing to unpack .../013-libglib2.0-0t64_2.80.1-1_arm64.deb ... Unpacking libglib2.0-0t64:arm64 (2.80.1-1) ... Selecting previously unselected package libicu72:arm64. Preparing to unpack .../014-libicu72_72.1-4+b1_arm64.deb ... Unpacking libicu72:arm64 (72.1-4+b1) ... Selecting previously unselected package libxml2:arm64. Preparing to unpack .../015-libxml2_2.9.14+dfsg-1.3+b3_arm64.deb ... Unpacking libxml2:arm64 (2.9.14+dfsg-1.3+b3) ... Selecting previously unselected package shared-mime-info. Preparing to unpack .../016-shared-mime-info_2.4-4_arm64.deb ... Unpacking shared-mime-info (2.4-4) ... Selecting previously unselected package libjpeg62-turbo:arm64. Preparing to unpack .../017-libjpeg62-turbo_1%3a2.1.5-3_arm64.deb ... Unpacking libjpeg62-turbo:arm64 (1:2.1.5-3) ... Selecting previously unselected package libpng16-16t64:arm64. Preparing to unpack .../018-libpng16-16t64_1.6.43-5_arm64.deb ... Unpacking libpng16-16t64:arm64 (1.6.43-5) ... Selecting previously unselected package libdeflate0:arm64. Preparing to unpack .../019-libdeflate0_1.20-1_arm64.deb ... Unpacking libdeflate0:arm64 (1.20-1) ... Selecting previously unselected package libjbig0:arm64. Preparing to unpack .../020-libjbig0_2.1-6.1+b1_arm64.deb ... Unpacking libjbig0:arm64 (2.1-6.1+b1) ... Selecting previously unselected package liblerc4:arm64. Preparing to unpack .../021-liblerc4_4.0.0+ds-4+b1_arm64.deb ... Unpacking liblerc4:arm64 (4.0.0+ds-4+b1) ... Selecting previously unselected package libsharpyuv0:arm64. Preparing to unpack .../022-libsharpyuv0_1.3.2-0.4+b1_arm64.deb ... Unpacking libsharpyuv0:arm64 (1.3.2-0.4+b1) ... Selecting previously unselected package libwebp7:arm64. Preparing to unpack .../023-libwebp7_1.3.2-0.4+b1_arm64.deb ... Unpacking libwebp7:arm64 (1.3.2-0.4+b1) ... Selecting previously unselected package libtiff6:arm64. Preparing to unpack .../024-libtiff6_4.5.1+git230720-4_arm64.deb ... Unpacking libtiff6:arm64 (4.5.1+git230720-4) ... Selecting previously unselected package libgdk-pixbuf-2.0-0:arm64. Preparing to unpack .../025-libgdk-pixbuf-2.0-0_2.42.10+dfsg-3+b3_arm64.deb ... Unpacking libgdk-pixbuf-2.0-0:arm64 (2.42.10+dfsg-3+b3) ... Selecting previously unselected package gtk-update-icon-cache. Preparing to unpack .../026-gtk-update-icon-cache_3.24.41-4_arm64.deb ... Unpacking gtk-update-icon-cache (3.24.41-4) ... Selecting previously unselected package hicolor-icon-theme. Preparing to unpack .../027-hicolor-icon-theme_0.17-2_all.deb ... Unpacking hicolor-icon-theme (0.17-2) ... Selecting previously unselected package adwaita-icon-theme. Preparing to unpack .../028-adwaita-icon-theme_46.0-1_all.deb ... Unpacking adwaita-icon-theme (46.0-1) ... Selecting previously unselected package ca-certificates-java. Preparing to unpack .../029-ca-certificates-java_20240118_all.deb ... Unpacking ca-certificates-java (20240118) ... Selecting previously unselected package java-common. Preparing to unpack .../030-java-common_0.75_all.deb ... Unpacking java-common (0.75) ... Selecting previously unselected package liblcms2-2:arm64. Preparing to unpack .../031-liblcms2-2_2.14-2+b1_arm64.deb ... Unpacking liblcms2-2:arm64 (2.14-2+b1) ... Selecting previously unselected package libnspr4:arm64. Preparing to unpack .../032-libnspr4_2%3a4.35-1.1+b1_arm64.deb ... Unpacking libnspr4:arm64 (2:4.35-1.1+b1) ... Selecting previously unselected package libnss3:arm64. Preparing to unpack .../033-libnss3_2%3a3.99-1_arm64.deb ... Unpacking libnss3:arm64 (2:3.99-1) ... Selecting previously unselected package libpcsclite1:arm64. Preparing to unpack .../034-libpcsclite1_2.0.3-1_arm64.deb ... Unpacking libpcsclite1:arm64 (2.0.3-1) ... Selecting previously unselected package openjdk-17-jre-headless:arm64. Preparing to unpack .../035-openjdk-17-jre-headless_17.0.11+9-1_arm64.deb ... Unpacking openjdk-17-jre-headless:arm64 (17.0.11+9-1) ... Selecting previously unselected package default-jre-headless. Preparing to unpack .../036-default-jre-headless_2%3a1.17-75_arm64.deb ... Unpacking default-jre-headless (2:1.17-75) ... Selecting previously unselected package ant. Preparing to unpack .../037-ant_1.10.14-1_all.deb ... Unpacking ant (1.10.14-1) ... Selecting previously unselected package ant-optional. Preparing to unpack .../038-ant-optional_1.10.14-1_all.deb ... Unpacking ant-optional (1.10.14-1) ... Selecting previously unselected package libantlr-java. Preparing to unpack .../039-libantlr-java_2.7.7+dfsg-13_all.deb ... Unpacking libantlr-java (2.7.7+dfsg-13) ... Selecting previously unselected package antlr. Preparing to unpack .../040-antlr_2.7.7+dfsg-13_all.deb ... Unpacking antlr (2.7.7+dfsg-13) ... Selecting previously unselected package at-spi2-common. Preparing to unpack .../041-at-spi2-common_2.52.0-1_all.deb ... Unpacking at-spi2-common (2.52.0-1) ... Selecting previously unselected package m4. Preparing to unpack .../042-m4_1.4.19-4_arm64.deb ... Unpacking m4 (1.4.19-4) ... Selecting previously unselected package autoconf. Preparing to unpack .../043-autoconf_2.71-3_all.deb ... Unpacking autoconf (2.71-3) ... Selecting previously unselected package autotools-dev. Preparing to unpack .../044-autotools-dev_20220109.1_all.deb ... Unpacking autotools-dev (20220109.1) ... Selecting previously unselected package automake. Preparing to unpack .../045-automake_1%3a1.16.5-1.3_all.deb ... Unpacking automake (1:1.16.5-1.3) ... Selecting previously unselected package autopoint. Preparing to unpack .../046-autopoint_0.21-14_all.deb ... Unpacking autopoint (0.21-14) ... Selecting previously unselected package unzip. Preparing to unpack .../047-unzip_6.0-28_arm64.deb ... Unpacking unzip (6.0-28) ... Selecting previously unselected package java-wrappers. Preparing to unpack .../048-java-wrappers_0.4_all.deb ... Unpacking java-wrappers (0.4) ... Selecting previously unselected package libhamcrest-java. Preparing to unpack .../049-libhamcrest-java_2.2-2_all.deb ... Unpacking libhamcrest-java (2.2-2) ... Selecting previously unselected package junit4. Preparing to unpack .../050-junit4_4.13.2-4_all.deb ... Unpacking junit4 (4.13.2-4) ... Selecting previously unselected package libfelix-framework-java. Preparing to unpack .../051-libfelix-framework-java_4.6.1-2.1_all.deb ... Unpacking libfelix-framework-java (4.6.1-2.1) ... Selecting previously unselected package libfelix-gogo-runtime-java. Preparing to unpack .../052-libfelix-gogo-runtime-java_0.16.2-1.1_all.deb ... Unpacking libfelix-gogo-runtime-java (0.16.2-1.1) ... Selecting previously unselected package libosgi-annotation-java. Preparing to unpack .../053-libosgi-annotation-java_8.1.0-1_all.deb ... Unpacking libosgi-annotation-java (8.1.0-1) ... Selecting previously unselected package libosgi-core-java. Preparing to unpack .../054-libosgi-core-java_8.0.0-2_all.deb ... Unpacking libosgi-core-java (8.0.0-2) ... Selecting previously unselected package libfelix-resolver-java. Preparing to unpack .../055-libfelix-resolver-java_1.16.0-1_all.deb ... Unpacking libfelix-resolver-java (1.16.0-1) ... Selecting previously unselected package libhawtjni-runtime-java. Preparing to unpack .../056-libhawtjni-runtime-java_1.18-1_all.deb ... Unpacking libhawtjni-runtime-java (1.18-1) ... Selecting previously unselected package libjansi-native-java. Preparing to unpack .../057-libjansi-native-java_1.8-2_all.deb ... Unpacking libjansi-native-java (1.8-2) ... Selecting previously unselected package libjansi1-java. Preparing to unpack .../058-libjansi1-java_1.18-3_all.deb ... Unpacking libjansi1-java (1.18-3) ... Selecting previously unselected package libjline2-java. Preparing to unpack .../059-libjline2-java_2.14.6-5_all.deb ... Unpacking libjline2-java (2.14.6-5) ... Selecting previously unselected package libosgi-compendium-java. Preparing to unpack .../060-libosgi-compendium-java_7.0.0-1_all.deb ... Unpacking libosgi-compendium-java (7.0.0-1) ... Selecting previously unselected package libslf4j-java. Preparing to unpack .../061-libslf4j-java_1.7.32-1_all.deb ... Unpacking libslf4j-java (1.7.32-1) ... Selecting previously unselected package libxz-java. Preparing to unpack .../062-libxz-java_1.9-1_all.deb ... Unpacking libxz-java (1.9-1) ... Selecting previously unselected package libyaml-snake-java. Preparing to unpack .../063-libyaml-snake-java_1.33-2_all.deb ... Unpacking libyaml-snake-java (1.33-2) ... Selecting previously unselected package bnd. Preparing to unpack .../064-bnd_5.0.1-5_all.deb ... Unpacking bnd (5.0.1-5) ... Selecting previously unselected package dctrl-tools. Preparing to unpack .../065-dctrl-tools_2.24-3_arm64.deb ... Unpacking dctrl-tools (2.24-3) ... Selecting previously unselected package libdebhelper-perl. Preparing to unpack .../066-libdebhelper-perl_13.15.3_all.deb ... Unpacking libdebhelper-perl (13.15.3) ... Selecting previously unselected package libtool. Preparing to unpack .../067-libtool_2.4.7-7_all.deb ... Unpacking libtool (2.4.7-7) ... Selecting previously unselected package dh-autoreconf. Preparing to unpack .../068-dh-autoreconf_20_all.deb ... Unpacking dh-autoreconf (20) ... Selecting previously unselected package libarchive-zip-perl. Preparing to unpack .../069-libarchive-zip-perl_1.68-1_all.deb ... Unpacking libarchive-zip-perl (1.68-1) ... Selecting previously unselected package libsub-override-perl. Preparing to unpack .../070-libsub-override-perl_0.10-1_all.deb ... Unpacking libsub-override-perl (0.10-1) ... Selecting previously unselected package libfile-stripnondeterminism-perl. Preparing to unpack .../071-libfile-stripnondeterminism-perl_1.13.1-1_all.deb ... Unpacking libfile-stripnondeterminism-perl (1.13.1-1) ... Selecting previously unselected package dh-strip-nondeterminism. Preparing to unpack .../072-dh-strip-nondeterminism_1.13.1-1_all.deb ... Unpacking dh-strip-nondeterminism (1.13.1-1) ... Selecting previously unselected package libelf1t64:arm64. Preparing to unpack .../073-libelf1t64_0.191-1+b1_arm64.deb ... Unpacking libelf1t64:arm64 (0.191-1+b1) ... Selecting previously unselected package dwz. Preparing to unpack .../074-dwz_0.15-1+b1_arm64.deb ... Unpacking dwz (0.15-1+b1) ... Selecting previously unselected package gettext. Preparing to unpack .../075-gettext_0.21-14+b1_arm64.deb ... Unpacking gettext (0.21-14+b1) ... Selecting previously unselected package intltool-debian. Preparing to unpack .../076-intltool-debian_0.35.0+20060710.6_all.deb ... Unpacking intltool-debian (0.35.0+20060710.6) ... Selecting previously unselected package po-debconf. Preparing to unpack .../077-po-debconf_1.0.21+nmu1_all.deb ... Unpacking po-debconf (1.0.21+nmu1) ... Selecting previously unselected package debhelper. Preparing to unpack .../078-debhelper_13.15.3_all.deb ... Unpacking debhelper (13.15.3) ... Selecting previously unselected package libgtk2.0-common. Preparing to unpack .../079-libgtk2.0-common_2.24.33-4_all.deb ... Unpacking libgtk2.0-common (2.24.33-4) ... Selecting previously unselected package libatk1.0-0t64:arm64. Preparing to unpack .../080-libatk1.0-0t64_2.52.0-1_arm64.deb ... Unpacking libatk1.0-0t64:arm64 (2.52.0-1) ... Selecting previously unselected package libbrotli1:arm64. Preparing to unpack .../081-libbrotli1_1.1.0-2+b3_arm64.deb ... Unpacking libbrotli1:arm64 (1.1.0-2+b3) ... Selecting previously unselected package libfreetype6:arm64. Preparing to unpack .../082-libfreetype6_2.13.2+dfsg-1+b4_arm64.deb ... Unpacking libfreetype6:arm64 (2.13.2+dfsg-1+b4) ... Selecting previously unselected package fonts-dejavu-mono. Preparing to unpack .../083-fonts-dejavu-mono_2.37-8_all.deb ... Unpacking fonts-dejavu-mono (2.37-8) ... Selecting previously unselected package fonts-dejavu-core. Preparing to unpack .../084-fonts-dejavu-core_2.37-8_all.deb ... Unpacking fonts-dejavu-core (2.37-8) ... Selecting previously unselected package fontconfig-config. Preparing to unpack .../085-fontconfig-config_2.15.0-1.1_arm64.deb ... Unpacking fontconfig-config (2.15.0-1.1) ... Selecting previously unselected package libfontconfig1:arm64. Preparing to unpack .../086-libfontconfig1_2.15.0-1.1_arm64.deb ... Unpacking libfontconfig1:arm64 (2.15.0-1.1) ... Selecting previously unselected package libpixman-1-0:arm64. Preparing to unpack .../087-libpixman-1-0_0.42.2-1+b1_arm64.deb ... Unpacking libpixman-1-0:arm64 (0.42.2-1+b1) ... Selecting previously unselected package libxau6:arm64. Preparing to unpack .../088-libxau6_1%3a1.0.9-1+b1_arm64.deb ... Unpacking libxau6:arm64 (1:1.0.9-1+b1) ... Selecting previously unselected package libbsd0:arm64. Preparing to unpack .../089-libbsd0_0.12.2-1_arm64.deb ... Unpacking libbsd0:arm64 (0.12.2-1) ... Selecting previously unselected package libxdmcp6:arm64. Preparing to unpack .../090-libxdmcp6_1%3a1.1.2-3+b1_arm64.deb ... Unpacking libxdmcp6:arm64 (1:1.1.2-3+b1) ... Selecting previously unselected package libxcb1:arm64. Preparing to unpack .../091-libxcb1_1.15-1_arm64.deb ... Unpacking libxcb1:arm64 (1.15-1) ... Selecting previously unselected package libx11-data. Preparing to unpack .../092-libx11-data_2%3a1.8.7-1_all.deb ... Unpacking libx11-data (2:1.8.7-1) ... Selecting previously unselected package libx11-6:arm64. Preparing to unpack .../093-libx11-6_2%3a1.8.7-1+b1_arm64.deb ... Unpacking libx11-6:arm64 (2:1.8.7-1+b1) ... Selecting previously unselected package libxcb-render0:arm64. Preparing to unpack .../094-libxcb-render0_1.15-1_arm64.deb ... Unpacking libxcb-render0:arm64 (1.15-1) ... Selecting previously unselected package libxcb-shm0:arm64. Preparing to unpack .../095-libxcb-shm0_1.15-1_arm64.deb ... Unpacking libxcb-shm0:arm64 (1.15-1) ... Selecting previously unselected package libxext6:arm64. Preparing to unpack .../096-libxext6_2%3a1.3.4-1+b1_arm64.deb ... Unpacking libxext6:arm64 (2:1.3.4-1+b1) ... Selecting previously unselected package libxrender1:arm64. Preparing to unpack .../097-libxrender1_1%3a0.9.10-1.1+b1_arm64.deb ... Unpacking libxrender1:arm64 (1:0.9.10-1.1+b1) ... Selecting previously unselected package libcairo2:arm64. Preparing to unpack .../098-libcairo2_1.18.0-3+b1_arm64.deb ... Unpacking libcairo2:arm64 (1.18.0-3+b1) ... Selecting previously unselected package libavahi-common-data:arm64. Preparing to unpack .../099-libavahi-common-data_0.8-13+b2_arm64.deb ... Unpacking libavahi-common-data:arm64 (0.8-13+b2) ... Selecting previously unselected package libavahi-common3:arm64. Preparing to unpack .../100-libavahi-common3_0.8-13+b2_arm64.deb ... Unpacking libavahi-common3:arm64 (0.8-13+b2) ... Selecting previously unselected package libdbus-1-3:arm64. Preparing to unpack .../101-libdbus-1-3_1.14.10-4+b1_arm64.deb ... Unpacking libdbus-1-3:arm64 (1.14.10-4+b1) ... Selecting previously unselected package libavahi-client3:arm64. Preparing to unpack .../102-libavahi-client3_0.8-13+b2_arm64.deb ... Unpacking libavahi-client3:arm64 (0.8-13+b2) ... Selecting previously unselected package libkrb5support0:arm64. Preparing to unpack .../103-libkrb5support0_1.20.1-6+b1_arm64.deb ... Unpacking libkrb5support0:arm64 (1.20.1-6+b1) ... Selecting previously unselected package libcom-err2:arm64. Preparing to unpack .../104-libcom-err2_1.47.1~rc2-1_arm64.deb ... Unpacking libcom-err2:arm64 (1.47.1~rc2-1) ... Selecting previously unselected package libk5crypto3:arm64. Preparing to unpack .../105-libk5crypto3_1.20.1-6+b1_arm64.deb ... Unpacking libk5crypto3:arm64 (1.20.1-6+b1) ... Selecting previously unselected package libkeyutils1:arm64. Preparing to unpack .../106-libkeyutils1_1.6.3-3_arm64.deb ... Unpacking libkeyutils1:arm64 (1.6.3-3) ... Selecting previously unselected package libkrb5-3:arm64. Preparing to unpack .../107-libkrb5-3_1.20.1-6+b1_arm64.deb ... Unpacking libkrb5-3:arm64 (1.20.1-6+b1) ... Selecting previously unselected package libgssapi-krb5-2:arm64. Preparing to unpack .../108-libgssapi-krb5-2_1.20.1-6+b1_arm64.deb ... Unpacking libgssapi-krb5-2:arm64 (1.20.1-6+b1) ... Selecting previously unselected package libcups2t64:arm64. Preparing to unpack .../109-libcups2t64_2.4.7-1.2+b1_arm64.deb ... Unpacking libcups2t64:arm64 (2.4.7-1.2+b1) ... Selecting previously unselected package fontconfig. Preparing to unpack .../110-fontconfig_2.15.0-1.1_arm64.deb ... Unpacking fontconfig (2.15.0-1.1) ... Selecting previously unselected package libfribidi0:arm64. Preparing to unpack .../111-libfribidi0_1.0.13-3+b1_arm64.deb ... Unpacking libfribidi0:arm64 (1.0.13-3+b1) ... Selecting previously unselected package libgraphite2-3:arm64. Preparing to unpack .../112-libgraphite2-3_1.3.14-2_arm64.deb ... Unpacking libgraphite2-3:arm64 (1.3.14-2) ... Selecting previously unselected package libharfbuzz0b:arm64. Preparing to unpack .../113-libharfbuzz0b_8.3.0-2+b1_arm64.deb ... Unpacking libharfbuzz0b:arm64 (8.3.0-2+b1) ... Selecting previously unselected package libthai-data. Preparing to unpack .../114-libthai-data_0.1.29-2_all.deb ... Unpacking libthai-data (0.1.29-2) ... Selecting previously unselected package libdatrie1:arm64. Preparing to unpack .../115-libdatrie1_0.2.13-3_arm64.deb ... Unpacking libdatrie1:arm64 (0.2.13-3) ... Selecting previously unselected package libthai0:arm64. Preparing to unpack .../116-libthai0_0.1.29-2_arm64.deb ... Unpacking libthai0:arm64 (0.1.29-2) ... Selecting previously unselected package libpango-1.0-0:arm64. Preparing to unpack .../117-libpango-1.0-0_1.52.2+ds-1_arm64.deb ... Unpacking libpango-1.0-0:arm64 (1.52.2+ds-1) ... Selecting previously unselected package libpangoft2-1.0-0:arm64. Preparing to unpack .../118-libpangoft2-1.0-0_1.52.2+ds-1_arm64.deb ... Unpacking libpangoft2-1.0-0:arm64 (1.52.2+ds-1) ... Selecting previously unselected package libpangocairo-1.0-0:arm64. Preparing to unpack .../119-libpangocairo-1.0-0_1.52.2+ds-1_arm64.deb ... Unpacking libpangocairo-1.0-0:arm64 (1.52.2+ds-1) ... Selecting previously unselected package libxcomposite1:arm64. Preparing to unpack .../120-libxcomposite1_1%3a0.4.5-1+b1_arm64.deb ... Unpacking libxcomposite1:arm64 (1:0.4.5-1+b1) ... Selecting previously unselected package libxfixes3:arm64. Preparing to unpack .../121-libxfixes3_1%3a6.0.0-2+b1_arm64.deb ... Unpacking libxfixes3:arm64 (1:6.0.0-2+b1) ... Selecting previously unselected package libxcursor1:arm64. Preparing to unpack .../122-libxcursor1_1%3a1.2.1-1+b1_arm64.deb ... Unpacking libxcursor1:arm64 (1:1.2.1-1+b1) ... Selecting previously unselected package libxdamage1:arm64. Preparing to unpack .../123-libxdamage1_1%3a1.1.6-1+b1_arm64.deb ... Unpacking libxdamage1:arm64 (1:1.1.6-1+b1) ... Selecting previously unselected package libxi6:arm64. Preparing to unpack .../124-libxi6_2%3a1.8.1-1_arm64.deb ... Unpacking libxi6:arm64 (2:1.8.1-1) ... Selecting previously unselected package libxinerama1:arm64. Preparing to unpack .../125-libxinerama1_2%3a1.1.4-3+b1_arm64.deb ... Unpacking libxinerama1:arm64 (2:1.1.4-3+b1) ... Selecting previously unselected package libxrandr2:arm64. Preparing to unpack .../126-libxrandr2_2%3a1.5.4-1_arm64.deb ... Unpacking libxrandr2:arm64 (2:1.5.4-1) ... Selecting previously unselected package libgtk2.0-0t64:arm64. Preparing to unpack .../127-libgtk2.0-0t64_2.24.33-4_arm64.deb ... Unpacking libgtk2.0-0t64:arm64 (2.24.33-4) ... Selecting previously unselected package libglvnd0:arm64. Preparing to unpack .../128-libglvnd0_1.7.0-1+b1_arm64.deb ... Unpacking libglvnd0:arm64 (1.7.0-1+b1) ... Selecting previously unselected package libdrm-common. Preparing to unpack .../129-libdrm-common_2.4.120-2_all.deb ... Unpacking libdrm-common (2.4.120-2) ... Selecting previously unselected package libdrm2:arm64. Preparing to unpack .../130-libdrm2_2.4.120-2_arm64.deb ... Unpacking libdrm2:arm64 (2.4.120-2) ... Selecting previously unselected package libglapi-mesa:arm64. Preparing to unpack .../131-libglapi-mesa_24.0.6-1+b1_arm64.deb ... Unpacking libglapi-mesa:arm64 (24.0.6-1+b1) ... Selecting previously unselected package libx11-xcb1:arm64. Preparing to unpack .../132-libx11-xcb1_2%3a1.8.7-1+b1_arm64.deb ... Unpacking libx11-xcb1:arm64 (2:1.8.7-1+b1) ... Selecting previously unselected package libxcb-dri2-0:arm64. Preparing to unpack .../133-libxcb-dri2-0_1.15-1_arm64.deb ... Unpacking libxcb-dri2-0:arm64 (1.15-1) ... Selecting previously unselected package libxcb-dri3-0:arm64. Preparing to unpack .../134-libxcb-dri3-0_1.15-1_arm64.deb ... Unpacking libxcb-dri3-0:arm64 (1.15-1) ... Selecting previously unselected package libxcb-glx0:arm64. Preparing to unpack .../135-libxcb-glx0_1.15-1_arm64.deb ... Unpacking libxcb-glx0:arm64 (1.15-1) ... Selecting previously unselected package libxcb-present0:arm64. Preparing to unpack .../136-libxcb-present0_1.15-1_arm64.deb ... Unpacking libxcb-present0:arm64 (1.15-1) ... Selecting previously unselected package libxcb-randr0:arm64. Preparing to unpack .../137-libxcb-randr0_1.15-1_arm64.deb ... Unpacking libxcb-randr0:arm64 (1.15-1) ... Selecting previously unselected package libxcb-sync1:arm64. Preparing to unpack .../138-libxcb-sync1_1.15-1_arm64.deb ... Unpacking libxcb-sync1:arm64 (1.15-1) ... Selecting previously unselected package libxcb-xfixes0:arm64. Preparing to unpack .../139-libxcb-xfixes0_1.15-1_arm64.deb ... Unpacking libxcb-xfixes0:arm64 (1.15-1) ... Selecting previously unselected package libxshmfence1:arm64. Preparing to unpack .../140-libxshmfence1_1.3-1+b1_arm64.deb ... Unpacking libxshmfence1:arm64 (1.3-1+b1) ... Selecting previously unselected package libxxf86vm1:arm64. Preparing to unpack .../141-libxxf86vm1_1%3a1.1.4-1+b2_arm64.deb ... Unpacking libxxf86vm1:arm64 (1:1.1.4-1+b2) ... Selecting previously unselected package libvulkan1:arm64. Preparing to unpack .../142-libvulkan1_1.3.280.0-1_arm64.deb ... Unpacking libvulkan1:arm64 (1.3.280.0-1) ... Selecting previously unselected package libdrm-amdgpu1:arm64. Preparing to unpack .../143-libdrm-amdgpu1_2.4.120-2_arm64.deb ... Unpacking libdrm-amdgpu1:arm64 (2.4.120-2) ... Selecting previously unselected package libdrm-nouveau2:arm64. Preparing to unpack .../144-libdrm-nouveau2_2.4.120-2_arm64.deb ... Unpacking libdrm-nouveau2:arm64 (2.4.120-2) ... Selecting previously unselected package libdrm-radeon1:arm64. Preparing to unpack .../145-libdrm-radeon1_2.4.120-2_arm64.deb ... Unpacking libdrm-radeon1:arm64 (2.4.120-2) ... Selecting previously unselected package libedit2:arm64. Preparing to unpack .../146-libedit2_3.1-20230828-1+b1_arm64.deb ... Unpacking libedit2:arm64 (3.1-20230828-1+b1) ... Selecting previously unselected package libz3-4:arm64. Preparing to unpack .../147-libz3-4_4.8.12-3.1+b2_arm64.deb ... Unpacking libz3-4:arm64 (4.8.12-3.1+b2) ... Selecting previously unselected package libllvm17t64:arm64. Preparing to unpack .../148-libllvm17t64_1%3a17.0.6-12_arm64.deb ... Unpacking libllvm17t64:arm64 (1:17.0.6-12) ... Selecting previously unselected package libsensors-config. Preparing to unpack .../149-libsensors-config_1%3a3.6.0-9_all.deb ... Unpacking libsensors-config (1:3.6.0-9) ... Selecting previously unselected package libsensors5:arm64. Preparing to unpack .../150-libsensors5_1%3a3.6.0-9_arm64.deb ... Unpacking libsensors5:arm64 (1:3.6.0-9) ... Selecting previously unselected package libgl1-mesa-dri:arm64. Preparing to unpack .../151-libgl1-mesa-dri_24.0.6-1+b1_arm64.deb ... Unpacking libgl1-mesa-dri:arm64 (24.0.6-1+b1) ... Selecting previously unselected package libglx-mesa0:arm64. Preparing to unpack .../152-libglx-mesa0_24.0.6-1+b1_arm64.deb ... Unpacking libglx-mesa0:arm64 (24.0.6-1+b1) ... Selecting previously unselected package libglx0:arm64. Preparing to unpack .../153-libglx0_1.7.0-1+b1_arm64.deb ... Unpacking libglx0:arm64 (1.7.0-1+b1) ... Selecting previously unselected package libgl1:arm64. Preparing to unpack .../154-libgl1_1.7.0-1+b1_arm64.deb ... Unpacking libgl1:arm64 (1.7.0-1+b1) ... Selecting previously unselected package libasound2-data. Preparing to unpack .../155-libasound2-data_1.2.11-1_all.deb ... Unpacking libasound2-data (1.2.11-1) ... Selecting previously unselected package libasound2t64:arm64. Preparing to unpack .../156-libasound2t64_1.2.11-1+b1_arm64.deb ... Unpacking libasound2t64:arm64 (1.2.11-1+b1) ... Selecting previously unselected package libgif7:arm64. Preparing to unpack .../157-libgif7_5.2.2-1_arm64.deb ... Unpacking libgif7:arm64 (5.2.2-1) ... Selecting previously unselected package x11-common. Preparing to unpack .../158-x11-common_1%3a7.7+23_all.deb ... Unpacking x11-common (1:7.7+23) ... Selecting previously unselected package libxtst6:arm64. Preparing to unpack .../159-libxtst6_2%3a1.2.3-1.1+b1_arm64.deb ... Unpacking libxtst6:arm64 (2:1.2.3-1.1+b1) ... Selecting previously unselected package openjdk-17-jre:arm64. Preparing to unpack .../160-openjdk-17-jre_17.0.11+9-1_arm64.deb ... Unpacking openjdk-17-jre:arm64 (17.0.11+9-1) ... Selecting previously unselected package default-jre. Preparing to unpack .../161-default-jre_2%3a1.17-75_arm64.deb ... Unpacking default-jre (2:1.17-75) ... Selecting previously unselected package openjdk-17-jdk-headless:arm64. Preparing to unpack .../162-openjdk-17-jdk-headless_17.0.11+9-1_arm64.deb ... Unpacking openjdk-17-jdk-headless:arm64 (17.0.11+9-1) ... Selecting previously unselected package default-jdk-headless. Preparing to unpack .../163-default-jdk-headless_2%3a1.17-75_arm64.deb ... Unpacking default-jdk-headless (2:1.17-75) ... Selecting previously unselected package openjdk-17-jdk:arm64. Preparing to unpack .../164-openjdk-17-jdk_17.0.11+9-1_arm64.deb ... Unpacking openjdk-17-jdk:arm64 (17.0.11+9-1) ... Selecting previously unselected package default-jdk. Preparing to unpack .../165-default-jdk_2%3a1.17-75_arm64.deb ... Unpacking default-jdk (2:1.17-75) ... Selecting previously unselected package libassuan0:arm64. Preparing to unpack .../166-libassuan0_2.5.6-1+b1_arm64.deb ... Unpacking libassuan0:arm64 (2.5.6-1+b1) ... Selecting previously unselected package gpgconf. Preparing to unpack .../167-gpgconf_2.2.40-3_arm64.deb ... Unpacking gpgconf (2.2.40-3) ... Selecting previously unselected package libksba8:arm64. Preparing to unpack .../168-libksba8_1.6.6-1_arm64.deb ... Unpacking libksba8:arm64 (1.6.6-1) ... Selecting previously unselected package libsasl2-modules-db:arm64. Preparing to unpack .../169-libsasl2-modules-db_2.1.28+dfsg1-6_arm64.deb ... Unpacking libsasl2-modules-db:arm64 (2.1.28+dfsg1-6) ... Selecting previously unselected package libsasl2-2:arm64. Preparing to unpack .../170-libsasl2-2_2.1.28+dfsg1-6_arm64.deb ... Unpacking libsasl2-2:arm64 (2.1.28+dfsg1-6) ... Selecting previously unselected package libldap-2.5-0:arm64. Preparing to unpack .../171-libldap-2.5-0_2.5.17+dfsg-1_arm64.deb ... Unpacking libldap-2.5-0:arm64 (2.5.17+dfsg-1) ... Selecting previously unselected package libnpth0t64:arm64. Preparing to unpack .../172-libnpth0t64_1.6-3.1_arm64.deb ... Unpacking libnpth0t64:arm64 (1.6-3.1) ... Selecting previously unselected package dirmngr. Preparing to unpack .../173-dirmngr_2.2.40-3_arm64.deb ... Unpacking dirmngr (2.2.40-3) ... Selecting previously unselected package gnupg-l10n. Preparing to unpack .../174-gnupg-l10n_2.2.40-3_all.deb ... Unpacking gnupg-l10n (2.2.40-3) ... Selecting previously unselected package gnupg-utils. Preparing to unpack .../175-gnupg-utils_2.2.40-3_arm64.deb ... Unpacking gnupg-utils (2.2.40-3) ... Selecting previously unselected package gpg. Preparing to unpack .../176-gpg_2.2.40-3_arm64.deb ... Unpacking gpg (2.2.40-3) ... Selecting previously unselected package pinentry-curses. Preparing to unpack .../177-pinentry-curses_1.2.1-3+b2_arm64.deb ... Unpacking pinentry-curses (1.2.1-3+b2) ... Selecting previously unselected package gpg-agent. Preparing to unpack .../178-gpg-agent_2.2.40-3_arm64.deb ... Unpacking gpg-agent (2.2.40-3) ... Selecting previously unselected package gpg-wks-client. Preparing to unpack .../179-gpg-wks-client_2.2.40-3_arm64.deb ... Unpacking gpg-wks-client (2.2.40-3) ... Selecting previously unselected package gpg-wks-server. Preparing to unpack .../180-gpg-wks-server_2.2.40-3_arm64.deb ... Unpacking gpg-wks-server (2.2.40-3) ... Selecting previously unselected package gpgsm. Preparing to unpack .../181-gpgsm_2.2.40-3_arm64.deb ... Unpacking gpgsm (2.2.40-3) ... Selecting previously unselected package gnupg. Preparing to unpack .../182-gnupg_2.2.40-3_all.deb ... Unpacking gnupg (2.2.40-3) ... Selecting previously unselected package libfile-dirlist-perl. Preparing to unpack .../183-libfile-dirlist-perl_0.05-3_all.deb ... Unpacking libfile-dirlist-perl (0.05-3) ... Selecting previously unselected package libfile-which-perl. Preparing to unpack .../184-libfile-which-perl_1.27-2_all.deb ... Unpacking libfile-which-perl (1.27-2) ... Selecting previously unselected package libfile-homedir-perl. Preparing to unpack .../185-libfile-homedir-perl_1.006-2_all.deb ... Unpacking libfile-homedir-perl (1.006-2) ... Selecting previously unselected package libfile-touch-perl. Preparing to unpack .../186-libfile-touch-perl_0.12-2_all.deb ... Unpacking libfile-touch-perl (0.12-2) ... Selecting previously unselected package libio-pty-perl. Preparing to unpack .../187-libio-pty-perl_1%3a1.20-1+b1_arm64.deb ... Unpacking libio-pty-perl (1:1.20-1+b1) ... Selecting previously unselected package libipc-run-perl. Preparing to unpack .../188-libipc-run-perl_20231003.0-2_all.deb ... Unpacking libipc-run-perl (20231003.0-2) ... Selecting previously unselected package libclass-method-modifiers-perl. Preparing to unpack .../189-libclass-method-modifiers-perl_2.15-1_all.deb ... Unpacking libclass-method-modifiers-perl (2.15-1) ... Selecting previously unselected package libclass-xsaccessor-perl. Preparing to unpack .../190-libclass-xsaccessor-perl_1.19-4+b3_arm64.deb ... Unpacking libclass-xsaccessor-perl (1.19-4+b3) ... Selecting previously unselected package libb-hooks-op-check-perl:arm64. Preparing to unpack .../191-libb-hooks-op-check-perl_0.22-3+b1_arm64.deb ... Unpacking libb-hooks-op-check-perl:arm64 (0.22-3+b1) ... Selecting previously unselected package libdynaloader-functions-perl. Preparing to unpack .../192-libdynaloader-functions-perl_0.003-3_all.deb ... Unpacking libdynaloader-functions-perl (0.003-3) ... Selecting previously unselected package libdevel-callchecker-perl:arm64. Preparing to unpack .../193-libdevel-callchecker-perl_0.009-1_arm64.deb ... Unpacking libdevel-callchecker-perl:arm64 (0.009-1) ... Selecting previously unselected package libparams-classify-perl:arm64. Preparing to unpack .../194-libparams-classify-perl_0.015-2+b3_arm64.deb ... Unpacking libparams-classify-perl:arm64 (0.015-2+b3) ... Selecting previously unselected package libmodule-runtime-perl. Preparing to unpack .../195-libmodule-runtime-perl_0.016-2_all.deb ... Unpacking libmodule-runtime-perl (0.016-2) ... Selecting previously unselected package libimport-into-perl. Preparing to unpack .../196-libimport-into-perl_1.002005-2_all.deb ... Unpacking libimport-into-perl (1.002005-2) ... Selecting previously unselected package librole-tiny-perl. Preparing to unpack .../197-librole-tiny-perl_2.002004-1_all.deb ... Unpacking librole-tiny-perl (2.002004-1) ... Selecting previously unselected package libsub-quote-perl. Preparing to unpack .../198-libsub-quote-perl_2.006008-1_all.deb ... Unpacking libsub-quote-perl (2.006008-1) ... Selecting previously unselected package libmoo-perl. Preparing to unpack .../199-libmoo-perl_2.005005-1_all.deb ... Unpacking libmoo-perl (2.005005-1) ... Selecting previously unselected package libencode-locale-perl. Preparing to unpack .../200-libencode-locale-perl_1.05-3_all.deb ... Unpacking libencode-locale-perl (1.05-3) ... Selecting previously unselected package libtimedate-perl. Preparing to unpack .../201-libtimedate-perl_2.3300-2_all.deb ... Unpacking libtimedate-perl (2.3300-2) ... Selecting previously unselected package libhttp-date-perl. Preparing to unpack .../202-libhttp-date-perl_6.06-1_all.deb ... Unpacking libhttp-date-perl (6.06-1) ... Selecting previously unselected package libfile-listing-perl. Preparing to unpack .../203-libfile-listing-perl_6.16-1_all.deb ... Unpacking libfile-listing-perl (6.16-1) ... Selecting previously unselected package libhtml-tagset-perl. Preparing to unpack .../204-libhtml-tagset-perl_3.24-1_all.deb ... Unpacking libhtml-tagset-perl (3.24-1) ... Selecting previously unselected package liburi-perl. Preparing to unpack .../205-liburi-perl_5.28-1_all.deb ... Unpacking liburi-perl (5.28-1) ... Selecting previously unselected package libhtml-parser-perl:arm64. Preparing to unpack .../206-libhtml-parser-perl_3.82-1_arm64.deb ... Unpacking libhtml-parser-perl:arm64 (3.82-1) ... Selecting previously unselected package libhtml-tree-perl. Preparing to unpack .../207-libhtml-tree-perl_5.07-3_all.deb ... Unpacking libhtml-tree-perl (5.07-3) ... Selecting previously unselected package libclone-perl:arm64. Preparing to unpack .../208-libclone-perl_0.46-1+b2_arm64.deb ... Unpacking libclone-perl:arm64 (0.46-1+b2) ... Selecting previously unselected package libio-html-perl. Preparing to unpack .../209-libio-html-perl_1.004-3_all.deb ... Unpacking libio-html-perl (1.004-3) ... Selecting previously unselected package liblwp-mediatypes-perl. Preparing to unpack .../210-liblwp-mediatypes-perl_6.04-2_all.deb ... Unpacking liblwp-mediatypes-perl (6.04-2) ... Selecting previously unselected package libhttp-message-perl. Preparing to unpack .../211-libhttp-message-perl_6.45-1_all.deb ... Unpacking libhttp-message-perl (6.45-1) ... Selecting previously unselected package libhttp-cookies-perl. Preparing to unpack .../212-libhttp-cookies-perl_6.11-1_all.deb ... Unpacking libhttp-cookies-perl (6.11-1) ... Selecting previously unselected package libhttp-negotiate-perl. Preparing to unpack .../213-libhttp-negotiate-perl_6.01-2_all.deb ... Unpacking libhttp-negotiate-perl (6.01-2) ... Selecting previously unselected package perl-openssl-defaults:arm64. Preparing to unpack .../214-perl-openssl-defaults_7+b2_arm64.deb ... Unpacking perl-openssl-defaults:arm64 (7+b2) ... Selecting previously unselected package libnet-ssleay-perl:arm64. Preparing to unpack .../215-libnet-ssleay-perl_1.94-1+b1_arm64.deb ... Unpacking libnet-ssleay-perl:arm64 (1.94-1+b1) ... Selecting previously unselected package libio-socket-ssl-perl. Preparing to unpack .../216-libio-socket-ssl-perl_2.085-1_all.deb ... Unpacking libio-socket-ssl-perl (2.085-1) ... Selecting previously unselected package libnet-http-perl. Preparing to unpack .../217-libnet-http-perl_6.23-1_all.deb ... Unpacking libnet-http-perl (6.23-1) ... Selecting previously unselected package liblwp-protocol-https-perl. Preparing to unpack .../218-liblwp-protocol-https-perl_6.14-1_all.deb ... Unpacking liblwp-protocol-https-perl (6.14-1) ... Selecting previously unselected package libtry-tiny-perl. Preparing to unpack .../219-libtry-tiny-perl_0.31-2_all.deb ... Unpacking libtry-tiny-perl (0.31-2) ... Selecting previously unselected package libwww-robotrules-perl. Preparing to unpack .../220-libwww-robotrules-perl_6.02-1_all.deb ... Unpacking libwww-robotrules-perl (6.02-1) ... Selecting previously unselected package libwww-perl. Preparing to unpack .../221-libwww-perl_6.77-1_all.deb ... Unpacking libwww-perl (6.77-1) ... Selecting previously unselected package patchutils. Preparing to unpack .../222-patchutils_0.4.2-1_arm64.deb ... Unpacking patchutils (0.4.2-1) ... Selecting previously unselected package wdiff. Preparing to unpack .../223-wdiff_1.2.2-6_arm64.deb ... Unpacking wdiff (1.2.2-6) ... Selecting previously unselected package devscripts. Preparing to unpack .../224-devscripts_2.23.7_all.deb ... Unpacking devscripts (2.23.7) ... Selecting previously unselected package fastjar. Preparing to unpack .../225-fastjar_2%3a0.98-7_arm64.deb ... Unpacking fastjar (2:0.98-7) ... Selecting previously unselected package ivy. Preparing to unpack .../226-ivy_2.5.2-1_all.deb ... Unpacking ivy (2.5.2-1) ... Selecting previously unselected package libasm-java. Preparing to unpack .../227-libasm-java_9.7-1_all.deb ... Unpacking libasm-java (9.7-1) ... Selecting previously unselected package libbsf-java. Preparing to unpack .../228-libbsf-java_1%3a2.4.0-8_all.deb ... Unpacking libbsf-java (1:2.4.0-8) ... Selecting previously unselected package libcommons-cli-java. Preparing to unpack .../229-libcommons-cli-java_1.6.0-1_all.deb ... Unpacking libcommons-cli-java (1.6.0-1) ... Selecting previously unselected package libapache-pom-java. Preparing to unpack .../230-libapache-pom-java_29-2_all.deb ... Unpacking libapache-pom-java (29-2) ... Selecting previously unselected package libcommons-parent-java. Preparing to unpack .../231-libcommons-parent-java_56-1_all.deb ... Unpacking libcommons-parent-java (56-1) ... Selecting previously unselected package libcommons-logging-java. Preparing to unpack .../232-libcommons-logging-java_1.3.0-1_all.deb ... Unpacking libcommons-logging-java (1.3.0-1) ... Selecting previously unselected package libjansi-java. Preparing to unpack .../233-libjansi-java_2.4.1-2_all.deb ... Unpacking libjansi-java (2.4.1-2) ... Selecting previously unselected package libjsp-api-java. Preparing to unpack .../234-libjsp-api-java_2.3.4-3_all.deb ... Unpacking libjsp-api-java (2.3.4-3) ... Selecting previously unselected package libqdox-java. Preparing to unpack .../235-libqdox-java_1.12.1-3_all.deb ... Unpacking libqdox-java (1.12.1-3) ... Selecting previously unselected package libservlet-api-java. Preparing to unpack .../236-libservlet-api-java_4.0.1-2_all.deb ... Unpacking libservlet-api-java (4.0.1-2) ... Selecting previously unselected package libxpp3-java. Preparing to unpack .../237-libxpp3-java_1.1.4c-3_all.deb ... Unpacking libxpp3-java (1.1.4c-3) ... Selecting previously unselected package libxstream-java. Preparing to unpack .../238-libxstream-java_1.4.20-1_all.deb ... Unpacking libxstream-java (1.4.20-1) ... Selecting previously unselected package groovy. Preparing to unpack .../239-groovy_2.4.21-10_all.deb ... Unpacking groovy (2.4.21-10) ... Selecting previously unselected package libatinject-jsr330-api-java. Preparing to unpack .../240-libatinject-jsr330-api-java_1.0+ds1-5_all.deb ... Unpacking libatinject-jsr330-api-java (1.0+ds1-5) ... Selecting previously unselected package libcommons-collections3-java. Preparing to unpack .../241-libcommons-collections3-java_3.2.2-3_all.deb ... Unpacking libcommons-collections3-java (3.2.2-3) ... Selecting previously unselected package libcommons-compress-java. Preparing to unpack .../242-libcommons-compress-java_1.25.0-1_all.deb ... Unpacking libcommons-compress-java (1.25.0-1) ... Selecting previously unselected package libcommons-io-java. Preparing to unpack .../243-libcommons-io-java_2.16.1-1_all.deb ... Unpacking libcommons-io-java (2.16.1-1) ... Selecting previously unselected package libcommons-lang-java. Preparing to unpack .../244-libcommons-lang-java_2.6-10_all.deb ... Unpacking libcommons-lang-java (2.6-10) ... Selecting previously unselected package liberror-prone-java. Preparing to unpack .../245-liberror-prone-java_2.18.0-1_all.deb ... Unpacking liberror-prone-java (2.18.0-1) ... Selecting previously unselected package libjsr305-java. Preparing to unpack .../246-libjsr305-java_0.1~+svn49-11_all.deb ... Unpacking libjsr305-java (0.1~+svn49-11) ... Selecting previously unselected package libguava-java. Preparing to unpack .../247-libguava-java_32.0.1-1_all.deb ... Unpacking libguava-java (32.0.1-1) ... Selecting previously unselected package libcommons-codec-java. Preparing to unpack .../248-libcommons-codec-java_1.16.0-1_all.deb ... Unpacking libcommons-codec-java (1.16.0-1) ... Selecting previously unselected package libhttpcore-java. Preparing to unpack .../249-libhttpcore-java_4.4.16-1_all.deb ... Unpacking libhttpcore-java (4.4.16-1) ... Selecting previously unselected package libhttpclient-java. Preparing to unpack .../250-libhttpclient-java_4.5.14-1_all.deb ... Unpacking libhttpclient-java (4.5.14-1) ... Selecting previously unselected package libjarjar-java. Preparing to unpack .../251-libjarjar-java_1.4+svn142-12_all.deb ... Unpacking libjarjar-java (1.4+svn142-12) ... Selecting previously unselected package libjcip-annotations-java. Preparing to unpack .../252-libjcip-annotations-java_20060626-6_all.deb ... Unpacking libjcip-annotations-java (20060626-6) ... Selecting previously unselected package libjna-jni. Preparing to unpack .../253-libjna-jni_5.14.0-1_arm64.deb ... Unpacking libjna-jni (5.14.0-1) ... Selecting previously unselected package libjna-java. Preparing to unpack .../254-libjna-java_5.14.0-1_all.deb ... Unpacking libjna-java (5.14.0-1) ... Selecting previously unselected package libjzlib-java. Preparing to unpack .../255-libjzlib-java_1.1.3-3_all.deb ... Unpacking libjzlib-java (1.1.3-3) ... Selecting previously unselected package libjsch-java. Preparing to unpack .../256-libjsch-java_0.1.55-1_all.deb ... Unpacking libjsch-java (0.1.55-1) ... Selecting previously unselected package libminlog-java. Preparing to unpack .../257-libminlog-java_1.3.0-1.1_all.deb ... Unpacking libminlog-java (1.3.0-1.1) ... Selecting previously unselected package libobjenesis-java. Preparing to unpack .../258-libobjenesis-java_3.3-3_all.deb ... Unpacking libobjenesis-java (3.3-3) ... Selecting previously unselected package libreflectasm-java. Preparing to unpack .../259-libreflectasm-java_1.11.9+dfsg-4_all.deb ... Unpacking libreflectasm-java (1.11.9+dfsg-4) ... Selecting previously unselected package libkryo-java. Preparing to unpack .../260-libkryo-java_2.20-7_all.deb ... Unpacking libkryo-java (2.20-7) ... Selecting previously unselected package liblogback-java. Preparing to unpack .../261-liblogback-java_1%3a1.2.11-5_all.deb ... Unpacking liblogback-java (1:1.2.11-5) ... Selecting previously unselected package libnative-platform-jni. Preparing to unpack .../262-libnative-platform-jni_0.14-6_arm64.deb ... Unpacking libnative-platform-jni (0.14-6) ... Selecting previously unselected package libnative-platform-java. Preparing to unpack .../263-libnative-platform-java_0.14-6_all.deb ... Unpacking libnative-platform-java (0.14-6) ... Selecting previously unselected package libxml-commons-external-java. Preparing to unpack .../264-libxml-commons-external-java_1.4.01-6_all.deb ... Unpacking libxml-commons-external-java (1.4.01-6) ... Selecting previously unselected package libxml-commons-resolver1.1-java. Preparing to unpack .../265-libxml-commons-resolver1.1-java_1.2-11_all.deb ... Unpacking libxml-commons-resolver1.1-java (1.2-11) ... Selecting previously unselected package libxerces2-java. Preparing to unpack .../266-libxerces2-java_2.12.2-1_all.deb ... Unpacking libxerces2-java (2.12.2-1) ... Selecting previously unselected package libnekohtml-java. Preparing to unpack .../267-libnekohtml-java_1.9.22.noko2-0.1_all.deb ... Unpacking libnekohtml-java (1.9.22.noko2-0.1) ... Selecting previously unselected package libxbean-reflect-java. Preparing to unpack .../268-libxbean-reflect-java_4.5-8_all.deb ... Unpacking libxbean-reflect-java (4.5-8) ... Selecting previously unselected package libgradle-core-java. Preparing to unpack .../269-libgradle-core-java_4.4.1-20_all.deb ... Unpacking libgradle-core-java (4.4.1-20) ... Selecting previously unselected package libbcprov-java. Preparing to unpack .../270-libbcprov-java_1.77-1_all.deb ... Unpacking libbcprov-java (1.77-1) ... Selecting previously unselected package libbcpg-java. Preparing to unpack .../271-libbcpg-java_1.77-1_all.deb ... Unpacking libbcpg-java (1.77-1) ... Selecting previously unselected package libbsh-java. Preparing to unpack .../272-libbsh-java_2.0b4-20_all.deb ... Unpacking libbsh-java (2.0b4-20) ... Selecting previously unselected package libdd-plist-java. Preparing to unpack .../273-libdd-plist-java_1.20-1.1_all.deb ... Unpacking libdd-plist-java (1.20-1.1) ... Selecting previously unselected package libjaxen-java. Preparing to unpack .../274-libjaxen-java_1.1.6-4_all.deb ... Unpacking libjaxen-java (1.1.6-4) ... Selecting previously unselected package libdom4j-java. Preparing to unpack .../275-libdom4j-java_2.1.4-1_all.deb ... Unpacking libdom4j-java (2.1.4-1) ... Selecting previously unselected package libbcel-java. Preparing to unpack .../276-libbcel-java_6.5.0-2_all.deb ... Unpacking libbcel-java (6.5.0-2) ... Selecting previously unselected package libjformatstring-java. Preparing to unpack .../277-libjformatstring-java_0.10~20131207-2.1_all.deb ... Unpacking libjformatstring-java (0.10~20131207-2.1) ... Selecting previously unselected package libfindbugs-java. Preparing to unpack .../278-libfindbugs-java_3.1.0~preview2-3_all.deb ... Unpacking libfindbugs-java (3.1.0~preview2-3) ... Selecting previously unselected package libgoogle-gson-java. Preparing to unpack .../279-libgoogle-gson-java_2.10.1-1_all.deb ... Unpacking libgoogle-gson-java (2.10.1-1) ... Selecting previously unselected package libaopalliance-java. Preparing to unpack .../280-libaopalliance-java_20070526-7_all.deb ... Unpacking libaopalliance-java (20070526-7) ... Selecting previously unselected package libguice-java. Preparing to unpack .../281-libguice-java_4.2.3-2_all.deb ... Unpacking libguice-java (4.2.3-2) ... Selecting previously unselected package libjatl-java. Preparing to unpack .../282-libjatl-java_0.2.3-1.1_all.deb ... Unpacking libjatl-java (0.2.3-1.1) ... Selecting previously unselected package libjcifs-java. Preparing to unpack .../283-libjcifs-java_1.3.19-2_all.deb ... Unpacking libjcifs-java (1.3.19-2) ... Selecting previously unselected package libeclipse-jdt-annotation-java. Preparing to unpack .../284-libeclipse-jdt-annotation-java_2.2.700+eclipse4.26-2_all.deb ... Unpacking libeclipse-jdt-annotation-java (2.2.700+eclipse4.26-2) ... Selecting previously unselected package libjavaewah-java. Preparing to unpack .../285-libjavaewah-java_1.2.3-1_all.deb ... Unpacking libjavaewah-java (1.2.3-1) ... Selecting previously unselected package libel-api-java. Preparing to unpack .../286-libel-api-java_3.0.0-3_all.deb ... Unpacking libel-api-java (3.0.0-3) ... Selecting previously unselected package libwebsocket-api-java. Preparing to unpack .../287-libwebsocket-api-java_1.1-2_all.deb ... Unpacking libwebsocket-api-java (1.1-2) ... Selecting previously unselected package libjetty9-java. Preparing to unpack .../288-libjetty9-java_9.4.54-1_all.deb ... Unpacking libjetty9-java (9.4.54-1) ... Selecting previously unselected package libjgit-java. Preparing to unpack .../289-libjgit-java_4.11.9-2_all.deb ... Unpacking libjgit-java (4.11.9-2) ... Selecting previously unselected package libjs-jquery. Preparing to unpack .../290-libjs-jquery_3.6.1+dfsg+~3.5.14-1_all.deb ... Unpacking libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Selecting previously unselected package libcommons-lang3-java. Preparing to unpack .../291-libcommons-lang3-java_3.14.0-1_all.deb ... Unpacking libcommons-lang3-java (3.14.0-1) ... Selecting previously unselected package libplexus-utils2-java. Preparing to unpack .../292-libplexus-utils2-java_3.4.2-1_all.deb ... Unpacking libplexus-utils2-java (3.4.2-1) ... Selecting previously unselected package libwagon-provider-api-java. Preparing to unpack .../293-libwagon-provider-api-java_3.5.3-1_all.deb ... Unpacking libwagon-provider-api-java (3.5.3-1) ... Selecting previously unselected package libmaven-resolver-java. Preparing to unpack .../294-libmaven-resolver-java_1.6.3-1_all.deb ... Unpacking libmaven-resolver-java (1.6.3-1) ... Selecting previously unselected package libgeronimo-annotation-1.3-spec-java. Preparing to unpack .../295-libgeronimo-annotation-1.3-spec-java_1.3-1_all.deb ... Unpacking libgeronimo-annotation-1.3-spec-java (1.3-1) ... Selecting previously unselected package libmaven-parent-java. Preparing to unpack .../296-libmaven-parent-java_35-1_all.deb ... Unpacking libmaven-parent-java (35-1) ... Selecting previously unselected package libmaven-shared-utils-java. Preparing to unpack .../297-libmaven-shared-utils-java_3.3.4-1_all.deb ... Unpacking libmaven-shared-utils-java (3.3.4-1) ... Selecting previously unselected package libplexus-cipher-java. Preparing to unpack .../298-libplexus-cipher-java_2.0-1_all.deb ... Unpacking libplexus-cipher-java (2.0-1) ... Selecting previously unselected package libplexus-classworlds-java. Preparing to unpack .../299-libplexus-classworlds-java_2.7.0-1_all.deb ... Unpacking libplexus-classworlds-java (2.7.0-1) ... Selecting previously unselected package libplexus-component-annotations-java. Preparing to unpack .../300-libplexus-component-annotations-java_2.1.1-1_all.deb ... Unpacking libplexus-component-annotations-java (2.1.1-1) ... Selecting previously unselected package libplexus-interpolation-java. Preparing to unpack .../301-libplexus-interpolation-java_1.26-1_all.deb ... Unpacking libplexus-interpolation-java (1.26-1) ... Selecting previously unselected package libplexus-sec-dispatcher-java. Preparing to unpack .../302-libplexus-sec-dispatcher-java_2.0-3_all.deb ... Unpacking libplexus-sec-dispatcher-java (2.0-3) ... Selecting previously unselected package libgeronimo-interceptor-3.0-spec-java. Preparing to unpack .../303-libgeronimo-interceptor-3.0-spec-java_1.0.1-4_all.deb ... Unpacking libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ... Selecting previously unselected package libcdi-api-java. Preparing to unpack .../304-libcdi-api-java_1.2-3_all.deb ... Unpacking libcdi-api-java (1.2-3) ... Selecting previously unselected package libsisu-inject-java. Preparing to unpack .../305-libsisu-inject-java_0.3.4-2_all.deb ... Unpacking libsisu-inject-java (0.3.4-2) ... Selecting previously unselected package libsisu-plexus-java. Preparing to unpack .../306-libsisu-plexus-java_0.3.4-3_all.deb ... Unpacking libsisu-plexus-java (0.3.4-3) ... Selecting previously unselected package libmaven3-core-java. Preparing to unpack .../307-libmaven3-core-java_3.8.7-2_all.deb ... Unpacking libmaven3-core-java (3.8.7-2) ... Selecting previously unselected package libplexus-container-default-java. Preparing to unpack .../308-libplexus-container-default-java_2.1.1-1_all.deb ... Unpacking libplexus-container-default-java (2.1.1-1) ... Selecting previously unselected package libpolyglot-maven-java. Preparing to unpack .../309-libpolyglot-maven-java_0.8~tobrien+git20120905-10_all.deb ... Unpacking libpolyglot-maven-java (0.8~tobrien+git20120905-10) ... Selecting previously unselected package librhino-java. Preparing to unpack .../310-librhino-java_1.7.14-2.1_all.deb ... Unpacking librhino-java (1.7.14-2.1) ... Selecting previously unselected package libsimple-http-java. Preparing to unpack .../311-libsimple-http-java_4.1.21-1.1_all.deb ... Unpacking libsimple-http-java (4.1.21-1.1) ... Selecting previously unselected package libwagon-file-java. Preparing to unpack .../312-libwagon-file-java_3.5.3-1_all.deb ... Unpacking libwagon-file-java (3.5.3-1) ... Selecting previously unselected package libjsoup-java. Preparing to unpack .../313-libjsoup-java_1.15.3-1_all.deb ... Unpacking libjsoup-java (1.15.3-1) ... Selecting previously unselected package libwagon-http-java. Preparing to unpack .../314-libwagon-http-java_3.5.3-1_all.deb ... Unpacking libwagon-http-java (3.5.3-1) ... Selecting previously unselected package libjcommander-java. Preparing to unpack .../315-libjcommander-java_1.71-4_all.deb ... Unpacking libjcommander-java (1.71-4) ... Selecting previously unselected package testng. Preparing to unpack .../316-testng_6.9.12-4_all.deb ... Unpacking testng (6.9.12-4) ... Selecting previously unselected package libgradle-plugins-java. Preparing to unpack .../317-libgradle-plugins-java_4.4.1-20_all.deb ... Unpacking libgradle-plugins-java (4.4.1-20) ... Selecting previously unselected package gradle. Preparing to unpack .../318-gradle_4.4.1-20_all.deb ... Unpacking gradle (4.4.1-20) ... Selecting previously unselected package maven-repo-helper. Preparing to unpack .../319-maven-repo-helper_1.11_all.deb ... Unpacking maven-repo-helper (1.11) ... Selecting previously unselected package gradle-debian-helper. Preparing to unpack .../320-gradle-debian-helper_2.4_all.deb ... Unpacking gradle-debian-helper (2.4) ... Selecting previously unselected package jarwrapper. Preparing to unpack .../321-jarwrapper_0.79_all.deb ... Unpacking jarwrapper (0.79) ... Selecting previously unselected package javahelper. Preparing to unpack .../322-javahelper_0.79_all.deb ... Unpacking javahelper (0.79) ... Selecting previously unselected package libbyte-buddy-java. Preparing to unpack .../323-libbyte-buddy-java_1.14.13-1_all.deb ... Unpacking libbyte-buddy-java (1.14.13-1) ... Selecting previously unselected package libcommons-math3-java. Preparing to unpack .../324-libcommons-math3-java_3.6.1-3_all.deb ... Unpacking libcommons-math3-java (3.6.1-3) ... Selecting previously unselected package libjackson2-annotations-java. Preparing to unpack .../325-libjackson2-annotations-java_2.14.0-1_all.deb ... Unpacking libjackson2-annotations-java (2.14.0-1) ... Selecting previously unselected package libjackson2-core-java. Preparing to unpack .../326-libjackson2-core-java_2.14.1-1_all.deb ... Unpacking libjackson2-core-java (2.14.1-1) ... Selecting previously unselected package libjackson2-databind-java. Preparing to unpack .../327-libjackson2-databind-java_2.14.0-1_all.deb ... Unpacking libjackson2-databind-java (2.14.0-1) ... Selecting previously unselected package liblz4-jni. Preparing to unpack .../328-liblz4-jni_1.8.0-4_arm64.deb ... Unpacking liblz4-jni (1.8.0-4) ... Selecting previously unselected package liblz4-java. Preparing to unpack .../329-liblz4-java_1.8.0-4_all.deb ... Unpacking liblz4-java (1.8.0-4) ... Selecting previously unselected package libmockito-java. Preparing to unpack .../330-libmockito-java_2.23.0-2_all.deb ... Unpacking libmockito-java (2.23.0-2) ... Selecting previously unselected package libredberry-pipe-java. Preparing to unpack .../331-libredberry-pipe-java_1.0.0~alpha0-3_all.deb ... Unpacking libredberry-pipe-java (1.0.0~alpha0-3) ... Selecting previously unselected package libtrove3-java. Preparing to unpack .../332-libtrove3-java_3.0.3-5_all.deb ... Unpacking libtrove3-java (3.0.3-5) ... Setting up libjcifs-java (1.3.19-2) ... Setting up libbcprov-java (1.77-1) ... Setting up libksba8:arm64 (1.6.6-1) ... Setting up media-types (10.1.0) ... Setting up libpipeline1:arm64 (1.5.7-2) ... Setting up fastjar (2:0.98-7) ... Setting up libgraphite2-3:arm64 (1.3.14-2) ... Setting up liblcms2-2:arm64 (2.14-2+b1) ... Setting up libpixman-1-0:arm64 (0.42.2-1+b1) ... Setting up libjcommander-java (1.71-4) ... Setting up libjackson2-annotations-java (2.14.0-1) ... Setting up wdiff (1.2.2-6) ... Setting up libsharpyuv0:arm64 (1.3.2-0.4+b1) ... Setting up libslf4j-java (1.7.32-1) ... Setting up libfile-which-perl (1.27-2) ... Setting up libxau6:arm64 (1:1.0.9-1+b1) ... Setting up libplexus-utils2-java (3.4.2-1) ... Setting up libnpth0t64:arm64 (1.6-3.1) ... Setting up libredberry-pipe-java (1.0.0~alpha0-3) ... Setting up libkeyutils1:arm64 (1.6.3-3) ... Setting up libplexus-classworlds-java (2.7.0-1) ... Setting up libqdox-java (1.12.1-3) ... Setting up libicu72:arm64 (72.1-4+b1) ... Setting up liblerc4:arm64 (4.0.0+ds-4+b1) ... Setting up libjsr305-java (0.1~+svn49-11) ... Setting up libsimple-http-java (4.1.21-1.1) ... Setting up bsdextrautils (2.40-8) ... Setting up hicolor-icon-theme (0.17-2) ... Setting up java-common (0.75) ... Setting up libdynaloader-functions-perl (0.003-3) ... Setting up libdatrie1:arm64 (0.2.13-3) ... Setting up libjcip-annotations-java (20060626-6) ... Setting up libobjenesis-java (3.3-3) ... Setting up libclass-method-modifiers-perl (2.15-1) ... Setting up libaopalliance-java (20070526-7) ... Setting up libcommons-cli-java (1.6.0-1) ... Setting up libio-pty-perl (1:1.20-1+b1) ... Setting up libmagic-mgc (1:5.45-3) ... Setting up liblogback-java (1:1.2.11-5) ... Setting up libclone-perl:arm64 (0.46-1+b2) ... Setting up libminlog-java (1.3.0-1.1) ... Setting up libarchive-zip-perl (1.68-1) ... Setting up libglvnd0:arm64 (1.7.0-1+b1) ... Setting up libgoogle-gson-java (2.10.1-1) ... Setting up libhtml-tagset-perl (3.24-1) ... Setting up unzip (6.0-28) ... Setting up libdebhelper-perl (13.15.3) ... Setting up libbrotli1:arm64 (1.1.0-2+b3) ... Setting up liblwp-mediatypes-perl (6.04-2) ... Setting up libgdk-pixbuf2.0-common (2.42.10+dfsg-3) ... Setting up libmagic1t64:arm64 (1:5.45-3) ... Setting up libasm-java (9.7-1) ... Setting up x11-common (1:7.7+23) ... invoke-rc.d: could not determine current runlevel Setting up X socket directories... /tmp/.X11-unix /tmp/.ICE-unix. Setting up libtry-tiny-perl (0.31-2) ... Setting up libsensors-config (1:3.6.0-9) ... Setting up libdeflate0:arm64 (1.20-1) ... Setting up perl-openssl-defaults:arm64 (7+b2) ... Setting up libdd-plist-java (1.20-1.1) ... Setting up gettext-base (0.21-14+b1) ... Setting up m4 (1.4.19-4) ... Setting up libel-api-java (3.0.0-3) ... Setting up libencode-locale-perl (1.05-3) ... Setting up libplexus-component-annotations-java (2.1.1-1) ... Setting up libcom-err2:arm64 (1.47.1~rc2-1) ... Setting up file (1:5.45-3) ... Setting up libpolyglot-maven-java (0.8~tobrien+git20120905-10) ... Setting up libfelix-gogo-runtime-java (0.16.2-1.1) ... Setting up libassuan0:arm64 (2.5.6-1+b1) ... Setting up libjzlib-java (1.1.3-3) ... Setting up libjbig0:arm64 (2.1-6.1+b1) ... Setting up libelf1t64:arm64 (0.191-1+b1) ... Setting up libkrb5support0:arm64 (1.20.1-6+b1) ... Setting up libsasl2-modules-db:arm64 (2.1.28+dfsg1-6) ... Setting up tzdata (2024a-4) ... Current default time zone: 'Etc/UTC' Local time is now: Fri Jun 13 14:20:43 UTC 2025. Universal Time is now: Fri Jun 13 14:20:43 UTC 2025. Run 'dpkg-reconfigure tzdata' if you wish to change it. Setting up libgeronimo-annotation-1.3-spec-java (1.3-1) ... Setting up libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ... Setting up libcommons-collections3-java (3.2.2-3) ... Setting up libasound2-data (1.2.11-1) ... Setting up libjsch-java (0.1.55-1) ... Setting up libreflectasm-java (1.11.9+dfsg-4) ... Setting up librhino-java (1.7.14-2.1) ... Setting up autotools-dev (20220109.1) ... Setting up libz3-4:arm64 (4.8.12-3.1+b2) ... Setting up libglib2.0-0t64:arm64 (2.80.1-1) ... No schema files found: doing nothing. Setting up libbsf-java (1:2.4.0-8) ... Setting up libosgi-annotation-java (8.1.0-1) ... Setting up libjformatstring-java (0.10~20131207-2.1) ... Setting up libasound2t64:arm64 (1.2.11-1+b1) ... Setting up libjavaewah-java (1.2.3-1) ... Setting up libjpeg62-turbo:arm64 (1:2.1.5-3) ... Setting up libjaxen-java (1.1.6-4) ... Setting up libx11-data (2:1.8.7-1) ... Setting up libnspr4:arm64 (2:4.35-1.1+b1) ... Setting up gnupg-l10n (2.2.40-3) ... Setting up libeclipse-jdt-annotation-java (2.2.700+eclipse4.26-2) ... Setting up libjansi-java (2.4.1-2) ... Setting up libapache-pom-java (29-2) ... Setting up libavahi-common-data:arm64 (0.8-13+b2) ... Setting up libxpp3-java (1.1.4c-3) ... Setting up libatinject-jsr330-api-java (1.0+ds1-5) ... Setting up libdbus-1-3:arm64 (1.14.10-4+b1) ... Setting up libwebsocket-api-java (1.1-2) ... Setting up libfribidi0:arm64 (1.0.13-3+b1) ... Setting up libplexus-interpolation-java (1.26-1) ... Setting up fonts-dejavu-mono (2.37-8) ... Setting up libpng16-16t64:arm64 (1.6.43-5) ... Setting up libxml-commons-resolver1.1-java (1.2-11) ... Setting up libkryo-java (2.20-7) ... Setting up libxz-java (1.9-1) ... Setting up libio-html-perl (1.004-3) ... Setting up libjna-jni (5.14.0-1) ... Setting up autopoint (0.21-14) ... Setting up binfmt-support (2.2.2-7) ... invoke-rc.d: could not determine current runlevel invoke-rc.d: policy-rc.d denied execution of start. Setting up libb-hooks-op-check-perl:arm64 (0.22-3+b1) ... Setting up fonts-dejavu-core (2.37-8) ... Setting up libfelix-framework-java (4.6.1-2.1) ... Setting up libipc-run-perl (20231003.0-2) ... Setting up libpcsclite1:arm64 (2.0.3-1) ... Setting up libsensors5:arm64 (1:3.6.0-9) ... Setting up libk5crypto3:arm64 (1.20.1-6+b1) ... Setting up libhamcrest-java (2.2-2) ... Setting up libglapi-mesa:arm64 (24.0.6-1+b1) ... Setting up libbsh-java (2.0b4-20) ... Setting up libjsp-api-java (2.3.4-3) ... Setting up libsasl2-2:arm64 (2.1.28+dfsg1-6) ... Setting up libvulkan1:arm64 (1.3.280.0-1) ... Setting up autoconf (2.71-3) ... Setting up libwebp7:arm64 (1.3.2-0.4+b1) ... Setting up libtimedate-perl (2.3300-2) ... Setting up libgif7:arm64 (5.2.2-1) ... Setting up libjarjar-java (1.4+svn142-12) ... Setting up libtrove3-java (3.0.3-5) ... Setting up dwz (0.15-1+b1) ... Setting up sensible-utils (0.0.22) ... Setting up libxshmfence1:arm64 (1.3-1+b1) ... Setting up libjsoup-java (1.15.3-1) ... Setting up at-spi2-common (2.52.0-1) ... Setting up libtiff6:arm64 (4.5.1+git230720-4) ... Setting up libuchardet0:arm64 (0.0.8-1+b1) ... Setting up libxml-commons-external-java (1.4.01-6) ... Setting up libjna-java (5.14.0-1) ... Setting up libxbean-reflect-java (4.5-8) ... Setting up libservlet-api-java (4.0.1-2) ... Setting up librole-tiny-perl (2.002004-1) ... Setting up libjackson2-core-java (2.14.1-1) ... Setting up libsub-override-perl (0.10-1) ... Setting up libthai-data (0.1.29-2) ... Setting up netbase (6.4) ... Setting up libcommons-math3-java (3.6.1-3) ... Setting up libsub-quote-perl (2.006008-1) ... Setting up libnative-platform-jni (0.14-6) ... Setting up libclass-xsaccessor-perl (1.19-4+b3) ... Setting up libgtk2.0-common (2.24.33-4) ... Setting up libkrb5-3:arm64 (1.20.1-6+b1) ... Setting up liblz4-jni (1.8.0-4) ... Setting up libhttpcore-java (4.4.16-1) ... Setting up libbcpg-java (1.77-1) ... Setting up libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Setting up libxerces2-java (2.12.2-1) ... Setting up libfile-dirlist-perl (0.05-3) ... Setting up libfile-homedir-perl (1.006-2) ... Setting up libantlr-java (2.7.7+dfsg-13) ... Setting up libyaml-snake-java (1.33-2) ... Setting up openssl (3.2.1-3) ... Setting up libbsd0:arm64 (0.12.2-1) ... Setting up libdrm-common (2.4.120-2) ... Setting up libcdi-api-java (1.2-3) ... Setting up readline-common (8.2-4) ... Setting up libhawtjni-runtime-java (1.18-1) ... Setting up libxml2:arm64 (2.9.14+dfsg-1.3+b3) ... Setting up liburi-perl (5.28-1) ... Setting up libfile-touch-perl (0.12-2) ... Setting up dctrl-tools (2.24-3) ... Setting up libjatl-java (0.2.3-1.1) ... Setting up libnet-ssleay-perl:arm64 (1.94-1+b1) ... Setting up automake (1:1.16.5-1.3) ... update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode Setting up pinentry-curses (1.2.1-3+b2) ... Setting up libdom4j-java (2.1.4-1) ... Setting up libfile-stripnondeterminism-perl (1.13.1-1) ... Setting up libwagon-provider-api-java (3.5.3-1) ... Setting up libnative-platform-java (0.14-6) ... Setting up libosgi-core-java (8.0.0-2) ... Setting up libhttp-date-perl (6.06-1) ... Setting up libxstream-java (1.4.20-1) ... Setting up libnekohtml-java (1.9.22.noko2-0.1) ... Setting up libxdmcp6:arm64 (1:1.1.2-3+b1) ... Setting up liblz4-java (1.8.0-4) ... Setting up libxcb1:arm64 (1.15-1) ... Setting up gettext (0.21-14+b1) ... Setting up libjetty9-java (9.4.54-1) ... Setting up libxcb-xfixes0:arm64 (1.15-1) ... Setting up java-wrappers (0.4) ... Setting up libatk1.0-0t64:arm64 (2.52.0-1) ... Setting up libfile-listing-perl (6.16-1) ... Setting up libosgi-compendium-java (7.0.0-1) ... Setting up jarwrapper (0.79) ... Setting up libtool (2.4.7-7) ... Setting up libxcb-render0:arm64 (1.15-1) ... Setting up fontconfig-config (2.15.0-1.1) ... Setting up libxcb-glx0:arm64 (1.15-1) ... Setting up libmaven-parent-java (35-1) ... Setting up libedit2:arm64 (3.1-20230828-1+b1) ... Setting up libcommons-parent-java (56-1) ... Setting up libavahi-common3:arm64 (0.8-13+b2) ... Setting up libcommons-logging-java (1.3.0-1) ... Setting up libnet-http-perl (6.23-1) ... Setting up libsisu-inject-java (0.3.4-2) ... Setting up libnss3:arm64 (2:3.99-1) ... Setting up libxcb-shm0:arm64 (1.15-1) ... Setting up libdevel-callchecker-perl:arm64 (0.009-1) ... Setting up libcommons-lang-java (2.6-10) ... Setting up libldap-2.5-0:arm64 (2.5.17+dfsg-1) ... Setting up libjackson2-databind-java (2.14.0-1) ... Setting up libplexus-cipher-java (2.0-1) ... Setting up intltool-debian (0.35.0+20060710.6) ... Setting up libxcb-present0:arm64 (1.15-1) ... Setting up dh-autoreconf (20) ... Setting up patchutils (0.4.2-1) ... Setting up libthai0:arm64 (0.1.29-2) ... Setting up ca-certificates (20240203) ... Updating certificates in /etc/ssl/certs... 146 added, 0 removed; done. Setting up libsisu-plexus-java (0.3.4-3) ... Setting up libbcel-java (6.5.0-2) ... Setting up libllvm17t64:arm64 (1:17.0.6-12) ... Setting up libfreetype6:arm64 (2.13.2+dfsg-1+b4) ... Setting up libxcb-sync1:arm64 (1.15-1) ... Setting up testng (6.9.12-4) ... Setting up shared-mime-info (2.4-4) ... Setting up libgssapi-krb5-2:arm64 (1.20.1-6+b1) ... Setting up libcommons-lang3-java (3.14.0-1) ... Setting up libreadline8t64:arm64 (8.2-4) ... Setting up libxcb-dri2-0:arm64 (1.15-1) ... Setting up dh-strip-nondeterminism (1.13.1-1) ... Setting up libwww-robotrules-perl (6.02-1) ... Setting up libfelix-resolver-java (1.16.0-1) ... Setting up libdrm2:arm64 (2.4.120-2) ... Setting up libjansi-native-java (1.8-2) ... Setting up groff-base (1.23.0-4) ... Setting up libxcb-randr0:arm64 (1.15-1) ... Setting up libhtml-parser-perl:arm64 (3.82-1) ... Setting up gpgconf (2.2.40-3) ... Setting up libjansi1-java (1.18-3) ... Setting up libplexus-sec-dispatcher-java (2.0-3) ... Setting up libx11-6:arm64 (2:1.8.7-1+b1) ... Setting up libharfbuzz0b:arm64 (8.3.0-2+b1) ... Setting up libgdk-pixbuf-2.0-0:arm64 (2.42.10+dfsg-3+b3) ... Setting up libfontconfig1:arm64 (2.15.0-1.1) ... Setting up ca-certificates-java (20240118) ... No JRE found. Skipping Java certificates setup. Setting up libwagon-file-java (3.5.3-1) ... Setting up libcommons-codec-java (1.16.0-1) ... Setting up libjline2-java (2.14.6-5) ... Setting up libxcomposite1:arm64 (1:0.4.5-1+b1) ... Setting up libavahi-client3:arm64 (0.8-13+b2) ... Setting up libio-socket-ssl-perl (2.085-1) ... Setting up gpg (2.2.40-3) ... Setting up gnupg-utils (2.2.40-3) ... Setting up libhttp-message-perl (6.45-1) ... Setting up libdrm-amdgpu1:arm64 (2.4.120-2) ... Setting up libxcb-dri3-0:arm64 (1.15-1) ... Setting up gtk-update-icon-cache (3.24.41-4) ... Setting up libx11-xcb1:arm64 (2:1.8.7-1+b1) ... Setting up libhttp-negotiate-perl (6.01-2) ... Setting up fontconfig (2.15.0-1.1) ... Regenerating fonts cache... done. Setting up libdrm-nouveau2:arm64 (2.4.120-2) ... Setting up libfindbugs-java (3.1.0~preview2-3) ... Setting up libxdamage1:arm64 (1:1.1.6-1+b1) ... Setting up gpg-agent (2.2.40-3) ... Setting up libxrender1:arm64 (1:0.9.10-1.1+b1) ... Setting up libcommons-compress-java (1.25.0-1) ... Setting up libhttp-cookies-perl (6.11-1) ... Setting up libcommons-io-java (2.16.1-1) ... Setting up libdrm-radeon1:arm64 (2.4.120-2) ... Setting up po-debconf (1.0.21+nmu1) ... Setting up libhtml-tree-perl (5.07-3) ... Setting up libpython3.11-stdlib:arm64 (3.11.9-1) ... Setting up libparams-classify-perl:arm64 (0.015-2+b3) ... Setting up gpgsm (2.2.40-3) ... Setting up libpango-1.0-0:arm64 (1.52.2+ds-1) ... Setting up libgl1-mesa-dri:arm64 (24.0.6-1+b1) ... Setting up libxext6:arm64 (2:1.3.4-1+b1) ... Setting up man-db (2.12.1-1) ... Not building database; man-db/auto-update is not 'true'. Setting up libcairo2:arm64 (1.18.0-3+b1) ... Setting up libxxf86vm1:arm64 (1:1.1.4-1+b2) ... Setting up dirmngr (2.2.40-3) ... Setting up libmaven-resolver-java (1.6.3-1) ... Setting up adwaita-icon-theme (46.0-1) ... update-alternatives: using /usr/share/icons/Adwaita/cursor.theme to provide /usr/share/icons/default/index.theme (x-cursor-theme) in auto mode Setting up libmodule-runtime-perl (0.016-2) ... Setting up libxfixes3:arm64 (1:6.0.0-2+b1) ... Setting up libxinerama1:arm64 (2:1.1.4-3+b1) ... Setting up libxrandr2:arm64 (2:1.5.4-1) ... Setting up openjdk-17-jre-headless:arm64 (17.0.11+9-1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/java to provide /usr/bin/java (java) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jpackage to provide /usr/bin/jpackage (jpackage) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/keytool to provide /usr/bin/keytool (keytool) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/rmiregistry to provide /usr/bin/rmiregistry (rmiregistry) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/lib/jexec to provide /usr/bin/jexec (jexec) in auto mode Setting up gpg-wks-server (2.2.40-3) ... Setting up libhttpclient-java (4.5.14-1) ... Setting up libwagon-http-java (3.5.3-1) ... Setting up libmaven-shared-utils-java (3.3.4-1) ... Setting up libpangoft2-1.0-0:arm64 (1.52.2+ds-1) ... Setting up libcups2t64:arm64 (2.4.7-1.2+b1) ... Setting up libpangocairo-1.0-0:arm64 (1.52.2+ds-1) ... Setting up libpython3-stdlib:arm64 (3.11.8-1) ... Setting up python3.11 (3.11.9-1) ... Setting up libjgit-java (4.11.9-2) ... Setting up libglx-mesa0:arm64 (24.0.6-1+b1) ... Setting up libxi6:arm64 (2:1.8.1-1) ... Setting up gpg-wks-client (2.2.40-3) ... Setting up libglx0:arm64 (1.7.0-1+b1) ... Setting up libimport-into-perl (1.002005-2) ... Setting up libxtst6:arm64 (2:1.2.3-1.1+b1) ... Setting up libmoo-perl (2.005005-1) ... Setting up libxcursor1:arm64 (1:1.2.1-1+b1) ... Setting up debhelper (13.15.3) ... Setting up python3 (3.11.8-1) ... Setting up libgl1:arm64 (1.7.0-1+b1) ... Setting up libgtk2.0-0t64:arm64 (2.24.33-4) ... Setting up gnupg (2.2.40-3) ... Setting up liberror-prone-java (2.18.0-1) ... Setting up libwww-perl (6.77-1) ... Setting up devscripts (2.23.7) ... Setting up libguava-java (32.0.1-1) ... Setting up javahelper (0.79) ... Setting up libplexus-container-default-java (2.1.1-1) ... Setting up liblwp-protocol-https-perl (6.14-1) ... Setting up libguice-java (4.2.3-2) ... Setting up libmaven3-core-java (3.8.7-2) ... Setting up libbyte-buddy-java (1.14.13-1) ... Setting up libmockito-java (2.23.0-2) ... Processing triggers for libc-bin (2.38-7) ... Processing triggers for ca-certificates-java (20240118) ... Adding debian:ACCVRAIZ1.pem Adding debian:AC_RAIZ_FNMT-RCM.pem Adding debian:AC_RAIZ_FNMT-RCM_SERVIDORES_SEGUROS.pem Adding debian:ANF_Secure_Server_Root_CA.pem Adding debian:Actalis_Authentication_Root_CA.pem Adding debian:AffirmTrust_Commercial.pem Adding debian:AffirmTrust_Networking.pem Adding debian:AffirmTrust_Premium.pem Adding debian:AffirmTrust_Premium_ECC.pem Adding debian:Amazon_Root_CA_1.pem Adding debian:Amazon_Root_CA_2.pem Adding debian:Amazon_Root_CA_3.pem Adding debian:Amazon_Root_CA_4.pem Adding debian:Atos_TrustedRoot_2011.pem Adding debian:Atos_TrustedRoot_Root_CA_ECC_TLS_2021.pem Adding debian:Atos_TrustedRoot_Root_CA_RSA_TLS_2021.pem Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068.pem Adding debian:BJCA_Global_Root_CA1.pem Adding debian:BJCA_Global_Root_CA2.pem Adding debian:Baltimore_CyberTrust_Root.pem Adding debian:Buypass_Class_2_Root_CA.pem Adding debian:Buypass_Class_3_Root_CA.pem Adding debian:CA_Disig_Root_R2.pem Adding debian:CFCA_EV_ROOT.pem Adding debian:COMODO_Certification_Authority.pem Adding debian:COMODO_ECC_Certification_Authority.pem Adding debian:COMODO_RSA_Certification_Authority.pem Adding debian:Certainly_Root_E1.pem Adding debian:Certainly_Root_R1.pem Adding debian:Certigna.pem Adding debian:Certigna_Root_CA.pem Adding debian:Certum_EC-384_CA.pem Adding debian:Certum_Trusted_Network_CA.pem Adding debian:Certum_Trusted_Network_CA_2.pem Adding debian:Certum_Trusted_Root_CA.pem Adding debian:CommScope_Public_Trust_ECC_Root-01.pem Adding debian:CommScope_Public_Trust_ECC_Root-02.pem Adding debian:CommScope_Public_Trust_RSA_Root-01.pem Adding debian:CommScope_Public_Trust_RSA_Root-02.pem Adding debian:Comodo_AAA_Services_root.pem Adding debian:D-TRUST_BR_Root_CA_1_2020.pem Adding debian:D-TRUST_EV_Root_CA_1_2020.pem Adding debian:D-TRUST_Root_Class_3_CA_2_2009.pem Adding debian:D-TRUST_Root_Class_3_CA_2_EV_2009.pem Adding debian:DigiCert_Assured_ID_Root_CA.pem Adding debian:DigiCert_Assured_ID_Root_G2.pem Adding debian:DigiCert_Assured_ID_Root_G3.pem Adding debian:DigiCert_Global_Root_CA.pem Adding debian:DigiCert_Global_Root_G2.pem Adding debian:DigiCert_Global_Root_G3.pem Adding debian:DigiCert_High_Assurance_EV_Root_CA.pem Adding debian:DigiCert_TLS_ECC_P384_Root_G5.pem Adding debian:DigiCert_TLS_RSA4096_Root_G5.pem Adding debian:DigiCert_Trusted_Root_G4.pem Adding debian:Entrust.net_Premium_2048_Secure_Server_CA.pem Adding debian:Entrust_Root_Certification_Authority.pem Adding debian:Entrust_Root_Certification_Authority_-_EC1.pem Adding debian:Entrust_Root_Certification_Authority_-_G2.pem Adding debian:Entrust_Root_Certification_Authority_-_G4.pem Adding debian:GDCA_TrustAUTH_R5_ROOT.pem Adding debian:GLOBALTRUST_2020.pem Adding debian:GTS_Root_R1.pem Adding debian:GTS_Root_R2.pem Adding debian:GTS_Root_R3.pem Adding debian:GTS_Root_R4.pem Adding debian:GlobalSign_ECC_Root_CA_-_R4.pem Adding debian:GlobalSign_ECC_Root_CA_-_R5.pem Adding debian:GlobalSign_Root_CA.pem Adding debian:GlobalSign_Root_CA_-_R3.pem Adding debian:GlobalSign_Root_CA_-_R6.pem Adding debian:GlobalSign_Root_E46.pem Adding debian:GlobalSign_Root_R46.pem Adding debian:Go_Daddy_Class_2_CA.pem Adding debian:Go_Daddy_Root_Certificate_Authority_-_G2.pem Adding debian:HARICA_TLS_ECC_Root_CA_2021.pem Adding debian:HARICA_TLS_RSA_Root_CA_2021.pem Adding debian:Hellenic_Academic_and_Research_Institutions_ECC_RootCA_2015.pem Adding debian:Hellenic_Academic_and_Research_Institutions_RootCA_2015.pem Adding debian:HiPKI_Root_CA_-_G1.pem Adding debian:Hongkong_Post_Root_CA_3.pem Adding debian:ISRG_Root_X1.pem Adding debian:ISRG_Root_X2.pem Adding debian:IdenTrust_Commercial_Root_CA_1.pem Adding debian:IdenTrust_Public_Sector_Root_CA_1.pem Adding debian:Izenpe.com.pem Adding debian:Microsec_e-Szigno_Root_CA_2009.pem Adding debian:Microsoft_ECC_Root_Certificate_Authority_2017.pem Adding debian:Microsoft_RSA_Root_Certificate_Authority_2017.pem Adding debian:NAVER_Global_Root_Certification_Authority.pem Adding debian:NetLock_Arany_=Class_Gold=_Főtanúsítvány.pem Adding debian:OISTE_WISeKey_Global_Root_GB_CA.pem Adding debian:OISTE_WISeKey_Global_Root_GC_CA.pem Adding debian:QuoVadis_Root_CA_1_G3.pem Adding debian:QuoVadis_Root_CA_2.pem Adding debian:QuoVadis_Root_CA_2_G3.pem Adding debian:QuoVadis_Root_CA_3.pem Adding debian:QuoVadis_Root_CA_3_G3.pem Adding debian:SSL.com_EV_Root_Certification_Authority_ECC.pem Adding debian:SSL.com_EV_Root_Certification_Authority_RSA_R2.pem Adding debian:SSL.com_Root_Certification_Authority_ECC.pem Adding debian:SSL.com_Root_Certification_Authority_RSA.pem Adding debian:SSL.com_TLS_ECC_Root_CA_2022.pem Adding debian:SSL.com_TLS_RSA_Root_CA_2022.pem Adding debian:SZAFIR_ROOT_CA2.pem Adding debian:Sectigo_Public_Server_Authentication_Root_E46.pem Adding debian:Sectigo_Public_Server_Authentication_Root_R46.pem Adding debian:SecureSign_RootCA11.pem Adding debian:SecureTrust_CA.pem Adding debian:Secure_Global_CA.pem Adding debian:Security_Communication_ECC_RootCA1.pem Adding debian:Security_Communication_RootCA2.pem Adding debian:Security_Communication_RootCA3.pem Adding debian:Security_Communication_Root_CA.pem Adding debian:Starfield_Class_2_CA.pem Adding debian:Starfield_Root_Certificate_Authority_-_G2.pem Adding debian:Starfield_Services_Root_Certificate_Authority_-_G2.pem Adding debian:SwissSign_Gold_CA_-_G2.pem Adding debian:SwissSign_Silver_CA_-_G2.pem Adding debian:T-TeleSec_GlobalRoot_Class_2.pem Adding debian:T-TeleSec_GlobalRoot_Class_3.pem Adding debian:TUBITAK_Kamu_SM_SSL_Kok_Sertifikasi_-_Surum_1.pem Adding debian:TWCA_Global_Root_CA.pem Adding debian:TWCA_Root_Certification_Authority.pem Adding debian:TeliaSonera_Root_CA_v1.pem Adding debian:Telia_Root_CA_v2.pem Adding debian:TrustAsia_Global_Root_CA_G3.pem Adding debian:TrustAsia_Global_Root_CA_G4.pem Adding debian:Trustwave_Global_Certification_Authority.pem Adding debian:Trustwave_Global_ECC_P256_Certification_Authority.pem Adding debian:Trustwave_Global_ECC_P384_Certification_Authority.pem Adding debian:TunTrust_Root_CA.pem Adding debian:UCA_Extended_Validation_Root.pem Adding debian:UCA_Global_G2_Root.pem Adding debian:USERTrust_ECC_Certification_Authority.pem Adding debian:USERTrust_RSA_Certification_Authority.pem Adding debian:XRamp_Global_CA_Root.pem Adding debian:certSIGN_ROOT_CA.pem Adding debian:certSIGN_Root_CA_G2.pem Adding debian:e-Szigno_Root_CA_2017.pem Adding debian:ePKI_Root_Certification_Authority.pem Adding debian:emSign_ECC_Root_CA_-_C3.pem Adding debian:emSign_ECC_Root_CA_-_G3.pem Adding debian:emSign_Root_CA_-_C1.pem Adding debian:emSign_Root_CA_-_G1.pem Adding debian:vTrus_ECC_Root_CA.pem Adding debian:vTrus_Root_CA.pem done. Setting up maven-repo-helper (1.11) ... Setting up antlr (2.7.7+dfsg-13) ... Setting up openjdk-17-jdk-headless:arm64 (17.0.11+9-1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jar to provide /usr/bin/jar (jar) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jarsigner to provide /usr/bin/jarsigner (jarsigner) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/javac to provide /usr/bin/javac (javac) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/javadoc to provide /usr/bin/javadoc (javadoc) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/javap to provide /usr/bin/javap (javap) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jcmd to provide /usr/bin/jcmd (jcmd) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jdb to provide /usr/bin/jdb (jdb) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jdeprscan to provide /usr/bin/jdeprscan (jdeprscan) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jdeps to provide /usr/bin/jdeps (jdeps) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jfr to provide /usr/bin/jfr (jfr) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jimage to provide /usr/bin/jimage (jimage) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jinfo to provide /usr/bin/jinfo (jinfo) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jlink to provide /usr/bin/jlink (jlink) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jmap to provide /usr/bin/jmap (jmap) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jmod to provide /usr/bin/jmod (jmod) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jps to provide /usr/bin/jps (jps) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jrunscript to provide /usr/bin/jrunscript (jrunscript) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jshell to provide /usr/bin/jshell (jshell) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jstack to provide /usr/bin/jstack (jstack) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jstat to provide /usr/bin/jstat (jstat) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jstatd to provide /usr/bin/jstatd (jstatd) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/serialver to provide /usr/bin/serialver (serialver) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jhsdb to provide /usr/bin/jhsdb (jhsdb) in auto mode Setting up ivy (2.5.2-1) ... Setting up ant (1.10.14-1) ... Setting up junit4 (4.13.2-4) ... Setting up groovy (2.4.21-10) ... update-alternatives: using /usr/share/groovy/bin/groovy to provide /usr/bin/groovy (groovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovyc to provide /usr/bin/groovyc (groovyc) in auto mode update-alternatives: using /usr/share/groovy/bin/grape to provide /usr/bin/grape (grape) in auto mode update-alternatives: using /usr/share/groovy/bin/startGroovy to provide /usr/bin/startGroovy (startGroovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovysh to provide /usr/bin/groovysh (groovysh) in auto mode update-alternatives: using /usr/share/groovy/bin/java2groovy to provide /usr/bin/java2groovy (java2groovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovyConsole to provide /usr/bin/groovyConsole (groovyConsole) in auto mode update-alternatives: using /usr/share/groovy/bin/groovydoc to provide /usr/bin/groovydoc (groovydoc) in auto mode Setting up default-jre-headless (2:1.17-75) ... Setting up openjdk-17-jre:arm64 (17.0.11+9-1) ... Setting up default-jre (2:1.17-75) ... Setting up openjdk-17-jdk:arm64 (17.0.11+9-1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jconsole to provide /usr/bin/jconsole (jconsole) in auto mode Setting up ant-optional (1.10.14-1) ... Setting up bnd (5.0.1-5) ... Setting up default-jdk-headless (2:1.17-75) ... Setting up libgradle-core-java (4.4.1-20) ... Setting up libgradle-plugins-java (4.4.1-20) ... Setting up gradle (4.4.1-20) ... Setting up default-jdk (2:1.17-75) ... Setting up gradle-debian-helper (2.4) ... Processing triggers for ca-certificates (20240203) ... Updating certificates in /etc/ssl/certs... 0 added, 0 removed; done. Running hooks in /etc/ca-certificates/update.d... done. Processing triggers for ca-certificates-java (20240118) ... done. Reading package lists... Building dependency tree... Reading state information... Reading extended state information... Initializing package states... Writing extended state information... Building tag database... -> Finished parsing the build-deps I: Building the package I: user script /srv/workspace/pbuilder/3151131/tmp/hooks/A99_set_merged_usr starting Not re-configuring usrmerge for trixie I: user script /srv/workspace/pbuilder/3151131/tmp/hooks/A99_set_merged_usr finished hostname: Name or service not known I: Running cd /build/reproducible-path/milib-2.2.0+dfsg/ && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path" HOME="/nonexistent/second-build" dpkg-buildpackage -us -uc -b && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path" HOME="/nonexistent/second-build" dpkg-genchanges -S > ../milib_2.2.0+dfsg-1_source.changes dpkg-buildpackage: info: source package milib dpkg-buildpackage: info: source version 2.2.0+dfsg-1 dpkg-buildpackage: info: source distribution unstable dpkg-buildpackage: info: source changed by Pierre Gruet dpkg-source --before-build . dpkg-buildpackage: info: host architecture arm64 debian/rules clean dh clean --with javahelper --with maven_repo_helper debian/rules override_dh_auto_clean make[1]: Entering directory '/build/reproducible-path/milib-2.2.0+dfsg' dh_auto_clean # Clearing the build.gradle file we provide rm build.gradle rm: cannot remove 'build.gradle': No such file or directory make[1]: [debian/rules:11: override_dh_auto_clean] Error 1 (ignored) make[1]: Leaving directory '/build/reproducible-path/milib-2.2.0+dfsg' jh_clean dh_clean debian/rules binary dh binary --with javahelper --with maven_repo_helper dh_update_autotools_config dh_autoreconf debian/rules override_dh_auto_configure make[1]: Entering directory '/build/reproducible-path/milib-2.2.0+dfsg' # Adding the upstream version number (without +dfsg) to the build.gradle file # we got by patching build.gradle.kts sed "s/\(^group.*\)/\1\nversion = '2.2.0+dfsg'/ ; s/\+dfsg[[:digit:]]*//" build.gradle.kts > build.gradle dh_auto_configure make[1]: Leaving directory '/build/reproducible-path/milib-2.2.0+dfsg' jh_linkjars dh_auto_build mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=12 jar openjdk version "17.0.11" 2024-04-16 OpenJDK Runtime Environment (build 17.0.11+9-Debian-1) OpenJDK 64-Bit Server VM (build 17.0.11+9-Debian-1, mixed mode, sharing) Initialized native services in: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/native To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-17-openjdk-arm64/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' An attempt to start the daemon took 3.039 secs. The client will now receive all logging from the daemon (pid: 3186911). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-3186911.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. Using 12 worker leases. Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@6038c7c5 Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@6038c7c5 Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@415dd4a4 Starting Build Compiling initialization script '/build/reproducible-path/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using SubsetScriptTransformer. Creating new cache for metadata-1.1/results, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@3356ca62 Compiling initialization script '/build/reproducible-path/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using BuildScriptTransformer. Settings evaluated using settings file '/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle'. Settings file not found (/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle) Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg' Projects loaded. Root project using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Included projects: [root project 'milib'] Keep-alive timer started Adding Debian repository to project 'milib' Parallel execution is an incubating feature. Evaluating root project 'milib' using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Compiling build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle' using SubsetScriptTransformer. Compiling build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle' using BuildScriptTransformer. Adding Maven pom generation to project 'milib' Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'jar' from project : Creating new cache for annotation-processors, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@2ac04560 Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':debianMavenPom', task ':jar'] Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@415dd4a4 Creating new cache for taskHistory, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@21f82911 Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@1aa802f9 :compileJava (Thread[Task worker for ':',5,main]) started. :compileJava Putting task artifact state for task ':compileJava' into context took 0.024 secs. Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@1e790dc8 Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0 -> com.fasterxml.jackson:jackson-bom:jar:debian Passing through com.fasterxml.jackson:jackson-parent:jar:debian Passing through com.fasterxml:oss-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x Passing through com.fasterxml.jackson:jackson-base:jar:debian Passing through com.fasterxml.jackson:jackson-bom:jar:debian Replacing org.apache.commons:commons-compress:jar:1.21 -> org.apache.commons:commons-compress:jar:debian Passing through org.apache.commons:commons-parent:jar:debian Passing through org.apache:apache:jar:debian Replacing commons-io:commons-io:jar:2.11.0 -> commons-io:commons-io:jar:debian Replacing org.lz4:lz4-java:jar:1.8.0 -> org.lz4:lz4-java:jar:debian Replacing com.beust:jcommander:jar:1.72 -> com.beust:jcommander:jar:debian Replacing net.sf.trove4j:trove4j:jar:3.0.3 -> net.sf.trove4j:trove4j:jar:debian Replacing com.google.guava:guava:jar:31.1-jre -> com.google.guava:guava:jar:debian Passing through com.google.guava:guava-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian Malformed jar [jackson-databind-2.x.jar] found on classpath. Gradle 5.0 will no longer allow malformed jars on a classpath. at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashMalformedZip(AbstractClasspathSnapshotBuilder.java:120) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashJarContents(AbstractClasspathSnapshotBuilder.java:115) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hash(AbstractClasspathSnapshotBuilder.java:93) at org.gradle.api.internal.changedetection.state.ResourceSnapshotterCacheService.hashFile(ResourceSnapshotterCacheService.java:44) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitJar(AbstractClasspathSnapshotBuilder.java:83) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitFileSnapshot(AbstractClasspathSnapshotBuilder.java:76) at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter$FileCollectionVisitorImpl.visitCollection(AbstractFileCollectionSnapshotter.java:77) at org.gradle.api.internal.file.AbstractFileCollection.visitRootElements(AbstractFileCollection.java:234) at org.gradle.api.internal.file.CompositeFileCollection.visitRootElements(CompositeFileCollection.java:185) at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter.snapshot(AbstractFileCollectionSnapshotter.java:53) at org.gradle.api.internal.changedetection.state.DefaultCompileClasspathSnapshotter.snapshot(DefaultCompileClasspathSnapshotter.java:38) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.snapshotTaskFiles(CacheBackedTaskHistoryRepository.java:331) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.createExecution(CacheBackedTaskHistoryRepository.java:154) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.access$100(CacheBackedTaskHistoryRepository.java:61) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository$1.getCurrentExecution(CacheBackedTaskHistoryRepository.java:114) at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.getStates(DefaultTaskArtifactStateRepository.java:201) at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.isUpToDate(DefaultTaskArtifactStateRepository.java:86) at org.gradle.api.internal.tasks.execution.SkipUpToDateTaskExecuter.execute(SkipUpToDateTaskExecuter.java:53) at org.gradle.api.internal.tasks.execution.ResolveTaskOutputCachingStateExecuter.execute(ResolveTaskOutputCachingStateExecuter.java:54) at org.gradle.api.internal.tasks.execution.ValidatingTaskExecuter.execute(ValidatingTaskExecuter.java:60) at org.gradle.api.internal.tasks.execution.SkipEmptySourceFilesTaskExecuter.execute(SkipEmptySourceFilesTaskExecuter.java:97) at org.gradle.api.internal.tasks.execution.CleanupStaleOutputsExecuter.execute(CleanupStaleOutputsExecuter.java:87) at org.gradle.api.internal.tasks.execution.ResolveTaskArtifactStateTaskExecuter.execute(ResolveTaskArtifactStateTaskExecuter.java:52) at org.gradle.api.internal.tasks.execution.SkipTaskWithNoActionsExecuter.execute(SkipTaskWithNoActionsExecuter.java:52) at org.gradle.api.internal.tasks.execution.SkipOnlyIfTaskExecuter.execute(SkipOnlyIfTaskExecuter.java:54) at org.gradle.api.internal.tasks.execution.ExecuteAtMostOnceTaskExecuter.execute(ExecuteAtMostOnceTaskExecuter.java:43) at org.gradle.api.internal.tasks.execution.CatchExceptionTaskExecuter.execute(CatchExceptionTaskExecuter.java:34) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker$1.run(DefaultTaskGraphExecuter.java:248) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:336) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:328) at org.gradle.internal.progress.DefaultBuildOperationExecutor.execute(DefaultBuildOperationExecutor.java:199) at org.gradle.internal.progress.DefaultBuildOperationExecutor.run(DefaultBuildOperationExecutor.java:110) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:241) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:230) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.processTask(DefaultTaskPlanExecutor.java:123) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.access$200(DefaultTaskPlanExecutor.java:79) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:104) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:98) at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.execute(DefaultTaskExecutionPlan.java:626) at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.executeWithTask(DefaultTaskExecutionPlan.java:581) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.run(DefaultTaskPlanExecutor.java:98) at org.gradle.internal.concurrent.ExecutorPolicy$CatchAndRecordFailures.onExecute(ExecutorPolicy.java:63) at org.gradle.internal.concurrent.ManagedExecutorImpl$1.run(ManagedExecutorImpl.java:46) at java.base/java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1136) at java.base/java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:635) at org.gradle.internal.concurrent.ThreadFactoryImpl$ManagedThreadRunnable.run(ThreadFactoryImpl.java:55) at java.base/java.lang.Thread.run(Thread.java:840) Up-to-date check for task ':compileJava' took 7.069 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileJava'. Compiling with JDK Java compiler API. Note: Some input files use or override a deprecated API. Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. :compileJava (Thread[Task worker for ':',5,main]) completed. Took 25.823 secs. :processResources (Thread[Task worker for ':',5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. Up-to-date check for task ':processResources' took 0.032 secs. It is not up-to-date because: No history is available. :processResources (Thread[Task worker for ':',5,main]) completed. Took 0.133 secs. :classes (Thread[Task worker for ':',5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes (Thread[Task worker for ':',5,main]) completed. Took 0.0 secs. :debianMavenPom (Thread[Task worker for ':',5,main]) started. :debianMavenPom Putting task artifact state for task ':debianMavenPom' into context took 0.0 secs. Up-to-date check for task ':debianMavenPom' took 0.007 secs. It is not up-to-date because: No history is available. Generating pom file /build/reproducible-path/milib-2.2.0+dfsg/build/debian/milib.pom :debianMavenPom (Thread[Task worker for ':',5,main]) completed. Took 0.265 secs. :jar (Thread[Task worker for ':',5,main]) started. :jar Putting task artifact state for task ':jar' into context took 0.0 secs. Up-to-date check for task ':jar' took 0.056 secs. It is not up-to-date because: No history is available. :jar (Thread[Task worker for ':',5,main]) completed. Took 0.546 secs. BUILD SUCCESSFUL in 42s 4 actionable tasks: 4 executed dh_auto_test mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=12 test openjdk version "17.0.11" 2024-04-16 OpenJDK Runtime Environment (build 17.0.11+9-Debian-1) OpenJDK 64-Bit Server VM (build 17.0.11+9-Debian-1, mixed mode, sharing) Initialized native services in: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/native To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-17-openjdk-arm64/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' An attempt to start the daemon took 3.363 secs. The client will now receive all logging from the daemon (pid: 3191687). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-3191687.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. Using 12 worker leases. Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@43ca8250 Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@43ca8250 Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@7c3de778 Starting Build Creating new cache for metadata-1.1/results, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@4332de6a Settings evaluated using settings file '/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle'. Settings file not found (/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle) Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg' Projects loaded. Root project using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Included projects: [root project 'milib'] Keep-alive timer started Adding Debian repository to project 'milib' Parallel execution is an incubating feature. Evaluating root project 'milib' using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Adding Maven pom generation to project 'milib' Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'test' from project : Creating new cache for annotation-processors, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@3657667f Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':compileTestJava', task ':processTestResources', task ':testClasses', task ':test'] Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@7c3de778 Creating new cache for taskHistory, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@52be3bc Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@41597d76 :compileJava (Thread[Task worker for ':',5,main]) started. :compileJava Putting task artifact state for task ':compileJava' into context took 0.139 secs. Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@327bb4e5 Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0 -> com.fasterxml.jackson:jackson-bom:jar:debian Passing through com.fasterxml.jackson:jackson-parent:jar:debian Passing through com.fasterxml:oss-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x Passing through com.fasterxml.jackson:jackson-base:jar:debian Passing through com.fasterxml.jackson:jackson-bom:jar:debian Replacing org.apache.commons:commons-compress:jar:1.21 -> org.apache.commons:commons-compress:jar:debian Passing through org.apache.commons:commons-parent:jar:debian Passing through org.apache:apache:jar:debian Replacing commons-io:commons-io:jar:2.11.0 -> commons-io:commons-io:jar:debian Replacing org.lz4:lz4-java:jar:1.8.0 -> org.lz4:lz4-java:jar:debian Replacing com.beust:jcommander:jar:1.72 -> com.beust:jcommander:jar:debian Replacing net.sf.trove4j:trove4j:jar:3.0.3 -> net.sf.trove4j:trove4j:jar:debian Replacing com.google.guava:guava:jar:31.1-jre -> com.google.guava:guava:jar:debian Passing through com.google.guava:guava-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian Skipping task ':compileJava' as it is up-to-date (took 2.414 secs). :compileJava UP-TO-DATE :compileJava (Thread[Task worker for ':',5,main]) completed. Took 2.627 secs. :processResources (Thread[Task worker for ':' Thread 2,5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. Skipping task ':processResources' as it is up-to-date (took 0.017 secs). :processResources UP-TO-DATE :processResources (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 0.025 secs. :classes (Thread[Task worker for ':' Thread 2,5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes UP-TO-DATE :classes (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 0.0 secs. :compileTestJava (Thread[Task worker for ':' Thread 2,5,main]) started. :compileTestJava Putting task artifact state for task ':compileTestJava' into context took 0.0 secs. Replacing junit:junit:jar:4.13.2 -> junit:junit:jar:4.x Replacing org.mockito:mockito-all:jar:1.10.19 -> org.mockito:mockito-all:jar:debian org.mockito:mockito-all:debian is relocated to org.mockito:mockito-core:debian. Please update your dependencies. Passing through org.hamcrest:hamcrest:jar:debian Passing through org.mockito:mockito-core:jar:debian Passing through net.bytebuddy:byte-buddy:jar:debian Passing through net.bytebuddy:byte-buddy-parent:jar:debian Passing through net.bytebuddy:byte-buddy-agent:jar:debian Passing through org.objenesis:objenesis:jar:debian Passing through org.objenesis:objenesis-parent:jar:debian Passing through net.bytebuddy:byte-buddy-dep:jar:debian Passing through org.ow2.asm:asm:jar:debian Passing through org.ow2.asm:asm-commons:jar:debian Up-to-date check for task ':compileTestJava' took 4.824 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileTestJava'. Compiling with JDK Java compiler API. Note: Some input files use or override a deprecated API. Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. :compileTestJava (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 19.465 secs. :processTestResources (Thread[Task worker for ':' Thread 2,5,main]) started. :processTestResources Putting task artifact state for task ':processTestResources' into context took 0.0 secs. Up-to-date check for task ':processTestResources' took 0.035 secs. It is not up-to-date because: No history is available. :processTestResources (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 0.139 secs. :testClasses (Thread[Task worker for ':' Thread 2,5,main]) started. :testClasses Skipping task ':testClasses' as it has no actions. :testClasses (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 0.0 secs. :test (Thread[Task worker for ':' Thread 2,5,main]) started. :test Putting task artifact state for task ':test' into context took 0.0 secs. Up-to-date check for task ':test' took 1.807 secs. It is not up-to-date because: No history is available. Starting process 'Gradle Test Executor 1'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg Command: /usr/lib/jvm/java-17-openjdk-arm64/bin/java -Dorg.gradle.native=false @/tmp/gradle-worker-classpath9111118893323196720txt -Xms1024m -Xmx2048m -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -ea worker.org.gradle.process.internal.worker.GradleWorkerMain 'Gradle Test Executor 1' Successfully started process 'Gradle Test Executor 1' Gradle Test Executor 1 started executing tests. com.milaboratory.test.TestUtil > testLT STANDARD_OUT Short tests. No system env properties. com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > benchmark1 SKIPPED com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > test1 STANDARD_OUT ================== High compression: false Concurrency: 4 File size: 5608636 Write time: 591.11ms O. Stats: Wall clock time: 592.91ms Total CPU time: 741.98ms User wait time: 454.88ms Serialization time: 568.06ms (76.56%) Checksum calculation time: 119.69ms (16.13%) Compression time: 31.67ms (4.27%) Total IO delay: 231.26ms Concurrency overhead: 119.65ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 5.35MiB (~617B per object; compression = 29.01%) IO speed: 23.16MiB/s Concurrency adjusted uncompressed speed: 50.93MiB/s Actual uncompressed speed: 31.14MiB/s Actual speed: 9.04MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 62 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 247.77ms Total CPU time: 186.49ms Serialization time: 125.56ms (67.33%) Checksum calculation time: 5.2ms (2.79%) Compression time: 51.39ms (27.56%) Total IO delay: 164.47ms Input size: 5.35MiB Decompressed size: 18.44MiB (compression = 29.01%) IO speed: 32.61MiB/s Concurrency adjusted uncompressed speed: 211.92MiB/s Actual uncompressed speed: 74.64MiB/s Actual speed: 21.66MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 62 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 466.25ms Total CPU time: 250.65ms Serialization time: 148.77ms (59.35%) Checksum calculation time: 10.46ms (4.17%) Compression time: 83.2ms (33.19%) Total IO delay: 320.33ms Input size: 10.7MiB Decompressed size: 36.87MiB (compression = 29.01%) IO speed: 33.43MiB/s Concurrency adjusted uncompressed speed: 259.67MiB/s Actual uncompressed speed: 79.13MiB/s Actual speed: 22.96MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 124 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 4 File size: 5588298 Write time: 222.34ms O. Stats: Wall clock time: 222.86ms Total CPU time: 105.26ms User wait time: 140ms Serialization time: 24.53ms (23.31%) Checksum calculation time: 16.56ms (15.73%) Compression time: 61.76ms (58.67%) Total IO delay: 84.68ms Concurrency overhead: 25.7ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 5.33MiB (~615B per object; compression = 28.91%) IO speed: 63.45MiB/s Concurrency adjusted uncompressed speed: 252.56MiB/s Actual uncompressed speed: 83.05MiB/s Actual speed: 24.01MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 20 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 199.4ms Total CPU time: 80.27ms Serialization time: 29.47ms (36.72%) Checksum calculation time: 13.03ms (16.23%) Compression time: 36.52ms (45.5%) Total IO delay: 161.89ms Input size: 5.33MiB Decompressed size: 18.44MiB (compression = 28.91%) IO speed: 33.1MiB/s Concurrency adjusted uncompressed speed: 307.28MiB/s Actual uncompressed speed: 92.65MiB/s Actual speed: 26.78MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 20 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 400.26ms Total CPU time: 158.17ms Serialization time: 51.8ms (32.75%) Checksum calculation time: 34.52ms (21.83%) Compression time: 69.37ms (43.86%) Total IO delay: 286.4ms Input size: 10.66MiB Decompressed size: 36.87MiB (compression = 28.91%) IO speed: 37.27MiB/s Concurrency adjusted uncompressed speed: 332.2MiB/s Actual uncompressed speed: 92.18MiB/s Actual speed: 26.65MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 40 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 1 File size: 5608636 Write time: 259.88ms O. Stats: Wall clock time: 260.97ms Total CPU time: 140.63ms User wait time: 235.55ms Serialization time: 104.4ms (74.24%) Checksum calculation time: 5.17ms (3.68%) Compression time: 24.86ms (17.68%) Total IO delay: 80.04ms Concurrency overhead: 13.57ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 5.35MiB (~617B per object; compression = 29.01%) IO speed: 66.86MiB/s Concurrency adjusted uncompressed speed: 78.79MiB/s Actual uncompressed speed: 70.91MiB/s Actual speed: 20.57MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 62 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 169.32ms Total CPU time: 70.95ms Serialization time: 27.92ms (39.35%) Checksum calculation time: 5.02ms (7.08%) Compression time: 34.62ms (48.79%) Total IO delay: 156.6ms Input size: 5.35MiB Decompressed size: 18.44MiB (compression = 29.01%) IO speed: 34.29MiB/s Concurrency adjusted uncompressed speed: 81.22MiB/s Actual uncompressed speed: 109.09MiB/s Actual speed: 31.65MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 62 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 345.46ms Total CPU time: 127.3ms Serialization time: 44.13ms (34.67%) Checksum calculation time: 10.12ms (7.95%) Compression time: 67.11ms (52.72%) Total IO delay: 286.48ms Input size: 10.7MiB Decompressed size: 36.87MiB (compression = 29.01%) IO speed: 37.4MiB/s Concurrency adjusted uncompressed speed: 89.28MiB/s Actual uncompressed speed: 106.88MiB/s Actual speed: 31.01MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 124 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 1 File size: 5588298 Write time: 137.93ms O. Stats: Wall clock time: 139.07ms Total CPU time: 55.51ms User wait time: 124.75ms Serialization time: 19.93ms (35.9%) Checksum calculation time: 5.19ms (9.34%) Compression time: 28.39ms (51.15%) Total IO delay: 57.48ms Concurrency overhead: 4.49ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 5.33MiB (~615B per object; compression = 28.91%) IO speed: 93.5MiB/s Concurrency adjusted uncompressed speed: 157.58MiB/s Actual uncompressed speed: 132.64MiB/s Actual speed: 38.34MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 20 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 107.6ms Total CPU time: 51.14ms Serialization time: 12.11ms (23.69%) Checksum calculation time: 7.06ms (13.81%) Compression time: 31.29ms (61.19%) Total IO delay: 80.48ms Input size: 5.33MiB Decompressed size: 18.44MiB (compression = 28.91%) IO speed: 66.62MiB/s Concurrency adjusted uncompressed speed: 140.74MiB/s Actual uncompressed speed: 172.31MiB/s Actual speed: 49.81MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 20 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 214.11ms Total CPU time: 103.02ms Serialization time: 22.86ms (22.19%) Checksum calculation time: 12.14ms (11.79%) Compression time: 66.72ms (64.76%) Total IO delay: 155.5ms Input size: 10.66MiB Decompressed size: 36.87MiB (compression = 28.91%) IO speed: 68.77MiB/s Concurrency adjusted uncompressed speed: 142.92MiB/s Actual uncompressed speed: 172.31MiB/s Actual speed: 49.81MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 40 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 4 ================== High compression: true Concurrency: 4 File size: 4156299 Write time: 2.77s O. Stats: Wall clock time: 2.77s Total CPU time: 6.99s User wait time: 2.54s Serialization time: 28ms (0.4%) Checksum calculation time: 4.96ms (0.07%) Compression time: 6.95s (99.49%) Total IO delay: 272.09ms Concurrency overhead: 99.96ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) IO speed: 14.57MiB/s Concurrency adjusted uncompressed speed: 9.63MiB/s Actual uncompressed speed: 6.67MiB/s Actual speed: 1.43MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 324.02ms Total CPU time: 72.11ms Serialization time: 14.54ms (20.16%) Checksum calculation time: 4.94ms (6.85%) Compression time: 49.42ms (68.54%) Total IO delay: 304.1ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) IO speed: 13.04MiB/s Concurrency adjusted uncompressed speed: 196.14MiB/s Actual uncompressed speed: 56.9MiB/s Actual speed: 12.23MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 561.46ms Total CPU time: 121.59ms Serialization time: 28.13ms (23.13%) Checksum calculation time: 9.89ms (8.13%) Compression time: 78.84ms (64.84%) Total IO delay: 442.02ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) IO speed: 17.94MiB/s Concurrency adjusted uncompressed speed: 263.38MiB/s Actual uncompressed speed: 65.73MiB/s Actual speed: 14.13MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 1 / 0 / 1 ================== High compression: true Concurrency: 4 File size: 4098671 Write time: 4.15s O. Stats: Wall clock time: 4.15s Total CPU time: 7.25s User wait time: 3.92s Serialization time: 23.95ms (0.33%) Checksum calculation time: 4.94ms (0.07%) Compression time: 7.22s (99.53%) Total IO delay: 112.92ms Concurrency overhead: 17.65ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) IO speed: 34.9MiB/s Concurrency adjusted uncompressed speed: 9.92MiB/s Actual uncompressed speed: 4.44MiB/s Actual speed: 964.95KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 82.94ms Total CPU time: 52.29ms Serialization time: 10.16ms (19.43%) Checksum calculation time: 8.41ms (16.09%) Compression time: 33.16ms (63.43%) Total IO delay: 65.27ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) IO speed: 60.14MiB/s Concurrency adjusted uncompressed speed: 635.76MiB/s Actual uncompressed speed: 224.84MiB/s Actual speed: 47.67MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 192.94ms Total CPU time: 106.08ms Serialization time: 29.23ms (27.56%) Checksum calculation time: 13.37ms (12.6%) Compression time: 62.47ms (58.89%) Total IO delay: 147.1ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) IO speed: 53.18MiB/s Concurrency adjusted uncompressed speed: 585.3MiB/s Actual uncompressed speed: 192.05MiB/s Actual speed: 40.72MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 40 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 ================== High compression: true Concurrency: 1 File size: 4156299 Write time: 4.26s O. Stats: Wall clock time: 4.26s Total CPU time: 4.21s User wait time: 4.24s Serialization time: 18.89ms (0.45%) Checksum calculation time: 5.06ms (0.12%) Compression time: 4.18s (99.36%) Total IO delay: 29.48ms Concurrency overhead: 3.18ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) IO speed: 136.68MiB/s Concurrency adjusted uncompressed speed: 4.35MiB/s Actual uncompressed speed: 4.32MiB/s Actual speed: 951.9KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 186.51ms Total CPU time: 51.94ms Serialization time: 14.85ms (28.6%) Checksum calculation time: 4.97ms (9.57%) Compression time: 30.43ms (58.59%) Total IO delay: 179.46ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) IO speed: 22.14MiB/s Concurrency adjusted uncompressed speed: 79.81MiB/s Actual uncompressed speed: 99.12MiB/s Actual speed: 21.31MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 426.92ms Total CPU time: 123.11ms Serialization time: 48.88ms (39.7%) Checksum calculation time: 9.91ms (8.05%) Compression time: 61ms (49.55%) Total IO delay: 408.41ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) IO speed: 19.43MiB/s Concurrency adjusted uncompressed speed: 69.44MiB/s Actual uncompressed speed: 86.56MiB/s Actual speed: 18.61MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 ================== High compression: true Concurrency: 1 File size: 4098671 Write time: 7.13s O. Stats: Wall clock time: 7.13s Total CPU time: 7.07s User wait time: 7.11s Serialization time: 16.11ms (0.23%) Checksum calculation time: 4.94ms (0.07%) Compression time: 7.05s (99.69%) Total IO delay: 23.41ms Concurrency overhead: 4.82ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) IO speed: 169.95MiB/s Concurrency adjusted uncompressed speed: 2.6MiB/s Actual uncompressed speed: 2.59MiB/s Actual speed: 561.77KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 128.45ms Total CPU time: 76.3ms Serialization time: 41.41ms (54.27%) Checksum calculation time: 5.08ms (6.65%) Compression time: 29.43ms (38.57%) Total IO delay: 98.61ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) IO speed: 39.89MiB/s Concurrency adjusted uncompressed speed: 105.96MiB/s Actual uncompressed speed: 144.04MiB/s Actual speed: 30.54MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 275.2ms Total CPU time: 123.62ms Serialization time: 53.72ms (43.46%) Checksum calculation time: 10.06ms (8.14%) Compression time: 58.92ms (47.66%) Total IO delay: 221.75ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) IO speed: 35.37MiB/s Concurrency adjusted uncompressed speed: 106.88MiB/s Actual uncompressed speed: 134.09MiB/s Actual speed: 28.43MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 40 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > bigBlocks STANDARD_OUT Pending / IO / Serde / Objs: 0 / 0 / 1 / 4000 Pending / IO / Serde / Objs: 0 / 0 / 1 / 9000 Pending / IO / Serde / Objs: 0 / 1 / 0 / 16000 O. Stats: Wall clock time: 7.46s Total CPU time: 6.14s User wait time: 51.04us Serialization time: 1.71s (27.84%) Checksum calculation time: 2.08s (33.8%) Compression time: 1.26s (20.54%) Total IO delay: 3.59s Concurrency overhead: 75.87ms Uncompressed size: 1.86GiB (~97.66KiB per object) Output size: 1.86GiB (~97.66KiB per object; compression = 100%) IO speed: 531.03MiB/s Concurrency adjusted uncompressed speed: 1.44GiB/s Actual uncompressed speed: 255.72MiB/s Actual speed: 255.72MiB/s Objects: 20000 Average object size uncompressed: 97.66KiB Average object size compressed: 97.66KiB Blocks: 20 (~95.37MiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 com.milaboratory.core.RangeTest > test23e14 STANDARD_OUT 1000001 1010100 1000111 1000011 1000010 com.milaboratory.core.alignment.AlignerCustomTest > testSemiLocal0 STANDARD_OUT 29.0 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 29.0 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 com.milaboratory.core.alignment.AlignerTest > testCalculateScore1 STANDARD_OUT 4.37us 1.02us 1.03us com.milaboratory.core.alignment.AlignmentHelperTest > test1 STANDARD_OUT 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 |||||||||||||||||||||||||||||| 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 30 TTGGT-ACAGCCTGGGGGGTCCCTGAGACT 58 |||| | |||||||||||||| |||||| 30 CTGGTCA-AGCCTGGGGGGTCCATGAGACA 58 59 CTCCTGTGCAGCCTCTGGATTCACCTTCAG 88 |||||||||||||||||||||| ||||||| 59 CTCCTGTGCAGCCTCTGGATTCCCCTTCAG 88 89 TAGC-TATAGCATGAACTGGGTCCGCCAGG 117 || | ||||||||||||||||||||||||| 89 TA-CTTATAGCATGAACTGGGTCCGCCAGG 117 118 CTCCAGGGAAGGGGCTGGAGTGGGTTTCAT 147 ||||||||||||||||||||||||| |||| 118 CTCCAGGGAAGGGGCTGGAGTGGGTCTCAT 147 148 ACATTAGTAGTAGTAGTAG-TACCATATAC 176 |||||||||| ||||||| || |||||| 148 CCATTAGTAGTGGTAGTAGTTA-CATATAT 176 177 TACGCAGACTCTGTGAAGGGCCGATTCACC 206 ||||||||||| |||||||||||||||||| 177 TACGCAGACTCCGTGAAGGGCCGATTCACC 206 207 ATCTCCAGAGACAATGCCAAGAACTCACTG 236 |||||||||||||| ||||||||||||||| 207 ATCTCCAGAGACAACGCCAAGAACTCACTG 236 237 TATCTGCAAATGAACAGCCTGAGAGACGAG 266 ||||||||||||||||||||||||| |||| 237 TATCTGCAAATGAACAGCCTGAGAGCCGAG 266 267 GACACGGCTGTGTATTACTGTGC 289 ||||||||||||||||||||||| 267 GACACGGCTGTGTATTACTGTGC 289 com.milaboratory.core.alignment.AlignmentIteratorTest > test1 STANDARD_OUT 0 -ATT-AGACA-- 7 ||| || | 0 AATTGGGA-ATT 10 I0AI3GSA3GDC6I8TI8T com.milaboratory.core.alignment.AlignmentTest > testInvert STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 0 AGACACATATACA 12 ||||||| ||||| 8 AGACACAGATACA 20 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 0 --------AGACACATATACACAG 15 ||||||| ||||| 0 GATACATTAGACACAGATACA--- 20 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 5 GATACATTAGAGACCACAGATACA 28 ||||||||||| |||||||||| 0 GATACATTAGA---CACAGATACA 20 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 0 GATACGATACATTAGAGACCACAGATACA 28 ||||| |||||| |||||||||| 0 GATAC-----ATTAGA---CACAGATACA 20 com.milaboratory.core.alignment.AlignmentTrimmerTest > testRandom1 STANDARD_OUT lTrimmed = 1715 rTrimmed = 1685 lTrimmed = 2845 rTrimmed = 2749 com.milaboratory.core.alignment.BandedAffineAlignerTest > test11 STANDARD_OUT 0 --------------------- -1 0 ATAAAAAAAAAAACGAGCTAG 20 0 --------------------- -1 0 ATAAAAAAAAAAACGAGCTAG 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test23 STANDARD_OUT 0 atgcggggatgc 11 0 atgcggggatgc 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test1 STANDARD_OUT 0 at-----------cgagctagTTTTTTTTTTT 20 0 atAAAAAAAAAAAcgagctag----------- 20 0 at-----------cgagctagTTTTTTTTTTT 20 0 atAAAAAAAAAAAcgagctag----------- 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test2 STANDARD_OUT 0 atgcGGGGatgc 11 0 atgcTA--atgc 9 0 atgcGGGGatgc----------- 11 0 atgcTA--atgcTTTTTTTTTTT 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test3 STANDARD_OUT 0 cgtaGGGGcgta 11 11 cgta--ATcgta 20 0 -----------cgtaGGGGcgta 11 0 TTTTTTTTTTTcgtaAT--cgta 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test4 STANDARD_OUT 0 atgcggggat-gTTTTT 15 0 atgcggggatAg----- 11 0 atgcggggat-gTTTTTTT 17 0 atgcggggatAg------- 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test5 STANDARD_OUT 7 g-taggggcgta 17 0 gAtaggggcgta 11 0 TTTTTTTg-taggggcgta 17 0 -------gAtaggggcgta 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test6 STANDARD_OUT 0 0 0 0 com.milaboratory.core.alignment.BandedAffineAlignerTest > semiGlobalLeft1 STANDARD_OUT 0 gCccTtgtgatgacccagactccagcctccgtgGAGgCaGctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctcttaGCCTGGTATCAGCAGAAACCAGGGCAGCCTCCCAAGCTCCTGATCTATTATGCATCCGATCTGGcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtAcactctcaccatcagTggcgtgcagtgtgccgatgctgccacttactac 260 1 gAccCtgtgatgacccagactccagcctccgtgTCTgAaCctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctctta-------------------------------------------------------------NNNcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtTcactctcaccatcagCggcgtgcagtgtgccgatgctgccacttactac 200 com.milaboratory.core.alignment.BandedLinearAlignerTest > testCase1 STANDARD_OUT GCGTGAAGACTGCAGGCATTGAGTACGTTACTAGTCCAGTGGGGCCCAACCGTAACATTGCGTGTGACTGGTTGCTTAGCGGGTGACGGCGTTTCAGGTTACGCCCTCTGTGCATCACCGATAGCGTTGTTTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATATATACACGAAAGGGGCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTCGAATTTTT AAAGCGTGAAGACTTGCAGGCATTGGTACGTTATTAGTCCAGTGGGGCCACAACCGTAACATTGCGTGTGACTGGTGCTTAGCGGGTGACGGCGTTCAGGTTACGCCCTCTGTGCATCACCGATTAGCGTTGTCTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATAGTATCACGAAAGGGTCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTTGAATTTTTCTA com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal1 STANDARD_OUT 1 AATTGACA 8 |||||| 0 TATTGACT 7 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal2 STANDARD_OUT 1 AATTGACAG 9 |||||| | 0 TATTGAC-G 7 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal3 STANDARD_OUT 0 TATTGACT 7 |||||| 1 AATTGACA 8 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal4 STANDARD_OUT 0 TATTGAC-G 7 |||||| | 1 AATTGACAG 9 com.milaboratory.core.alignment.MultiAlignmentHelperTest > test1 STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 Quality 78778 878777 7778887878 Subject 0 GATAC-----ATTAGA---CACAGATACA--- 20 Query0 0 aga---cacaTataca 12 Query1 0 -------------aga---cacaTatacaCAG 15 Query2 5 gatac-----attagaGACcacagataca 28 Query3 0 gatacGATACattagaGACcacagataca 28 Quality 78778 Subject 0 GATAC 4 Query1 0 ----- 0 Query2 5 gatac 9 Query3 0 gatac 4 Quality Subject 5 ----- 5 Query1 0 ----- 0 Query2 10 ----- 10 Query3 5 GATAC 9 Quality 87877 Subject 5 ATTAG 9 Query0 0 ag 1 Query1 0 ---ag 1 Query2 10 attag 14 Query3 10 attag 14 Quality 7 7 Subject 10 A---C 11 Query0 2 a---c 3 Query1 2 a---c 3 Query2 15 aGACc 19 Query3 15 aGACc 19 Quality 77888 Subject 12 ACAGA 16 Query0 4 acaTa 8 Query1 4 acaTa 8 Query2 20 acaga 24 Query3 20 acaga 24 Quality 7878 Subject 17 TACA- 20 Query0 9 taca 12 Query1 9 tacaC 13 Query2 25 taca 28 Query3 25 taca 28 Quality Subject 21 -- 21 Query1 14 AG 15 0 GATAC-----ATTAGA---CACAGATACA--- 20 0 ...---....T..... 12 0 -------------...---....T.....CAG 15 5 .....-----......GAC.......... 28 0 .....GATAC......GAC.......... 28 787788787777778887878 0 GATACATTAGACACAGATACA 20 com.milaboratory.core.alignment.MultiAlignmentHelperTest > test2 STANDARD_OUT 15 TATAGGGAGAACTCCGATCGACATCG 40 ||||||||| ||||||||||||||| 0 TATAGGGAG--CTCCGATCGACATCG 23 56 CGATCC--CGGTGACAAAGCGTTCGGACC 82 |||||| ||||||||||||||||||||| 0 CGATCCTTCGGTGACAAAGCGTTCGGACC 28 36 CATCGGGTATCGCCCTGGTACG 57 |||| ||||||||||||||||| 0 CATCAGGTATCGCCCTGGTACG 21 0 AACGATGGGCGCAAATATAGGGAGAACTCCGATCGACATCGGGTATCGCCCTGGTACGATCC--CGGTGACAAAGCGTTCGGACCTGTCTGGACGCTAGAACGC 101 0 tatagggag--ctccgatcgacatcg 23 0 cgatccTTcggtgacaaagcgttcggacc 28 0 catcAggtatcgccctggtacg 21 com.milaboratory.core.alignment.batch.SimpleBatchAlignerTest > test1 STANDARD_OUT 4 hits. com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test16SMicrobial1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT2 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT3 SKIPPED com.milaboratory.core.alignment.blast.BlastDBBuilderTest > test1 SKIPPED com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectness STANDARD_OUT C=1182;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 450.16us C=1642;I=1;M=0;ScE=0;R=0.0 AlignmentTime = 280.62us C=2048;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 130.08us C=2142;I=0;M=0;ScE=0;R=8.333333333333333E-7 AlignmentTime = 164.91us com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandom1 STANDARD_OUT ##teamcity[buildStatisticValue key='kmFound' value='0.9449'] ##teamcity[buildStatisticValue key='kmWrong' value='1.0E-4'] ##teamcity[buildStatisticValue key='kmFalse' value='0.0058'] com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectnessConcurrent STANDARD_OUT C=2999;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 177.63us C=2996;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 272.08us C=2996;I=0;M=1;ScE=0;R=0.0 AlignmentTime = 179.24us C=2995;I=0;M=1;ScE=0;R=0.0 AlignmentTime = 182.11us com.milaboratory.core.alignment.kaligner1.KMapperTest > testBestOffset2 STANDARD_OUT -205 com.milaboratory.core.alignment.kaligner2.KMapper2Test > test11112 STANDARD_OUT ID: 0 Score: 1623 Cluster 0: Q 27 -> T 15 - -12 Q 30 -> T 18 - -12 Q 39 -> T 28 - -11 Q 42 -> T 31 - -11 Q 45 -> T 34 - -11 Q 48 -> T 37 - -11 Q 51 -> T 40 - -11 Cluster 1: Q 84 -> T 50 - -34 Q 87 -> T 53 - -34 Q 90 -> T 56 - -34 Q 93 -> T 59 - -34 Q 96 -> T 62 - -34 Q 99 -> T 65 - -34 Q 114 -> T 82 - -32 Cluster 2: Q 153 -> T 95 - -58 Q 156 -> T 98 - -58 Q 159 -> T 101 - -58 Cluster 3: Q 201 -> T 123 - -78 Q 204 -> T 126 - -78 Q 207 -> T 129 - -78 Q 210 -> T 132 - -78 Q 216 -> T 139 - -77 Q 219 -> T 142 - -77 Q 222 -> T 145 - -77 Q 231 -> T 153 - -78 Q 234 -> T 156 - -78 Q 237 -> T 159 - -78 Cluster 4: Q 246 -> T 178 - -68 Q 249 -> T 181 - -68 Q 252 -> T 184 - -68 Q 255 -> T 187 - -68 Q 258 -> T 190 - -68 Q 261 -> T 193 - -68 Q 262 -> T 194 - -68 com.milaboratory.core.alignment.kaligner2.KMapper2Test > test1111 STANDARD_OUT ID: 0 Score: 1161 Cluster 0: Q 9 -> T 15 - 6 Q 12 -> T 18 - 6 Q 15 -> T 21 - 6 Q 18 -> T 24 - 6 Q 21 -> T 27 - 6 Q 24 -> T 30 - 6 Q 27 -> T 33 - 6 Q 30 -> T 36 - 6 Cluster 1: Q 60 -> T 51 - -9 Q 69 -> T 61 - -8 Q 78 -> T 69 - -9 Q 81 -> T 72 - -9 Q 84 -> T 75 - -9 Cluster 2: Q 123 -> T 89 - -34 Q 126 -> T 92 - -34 Q 129 -> T 95 - -34 Q 132 -> T 98 - -34 Q 135 -> T 101 - -34 Q 150 -> T 116 - -34 Q 168 -> T 132 - -36 Q 171 -> T 135 - -36 Q 174 -> T 138 - -36 Q 177 -> T 141 - -36 Q 180 -> T 144 - -36 Q 185 -> T 149 - -36 com.milaboratory.core.alignment.kaligner2.KMapper2Test > testRandom1 STANDARD_OUT noHits: 262 noHits2: 0 noHits3: 0 wrongTopHit: 42 wrongTopHitS: 33 noCorrectHitInList: 20 Timings: DescriptiveStatistics: n: 100000 min: 4600.0 max: 4.7612864E8 mean: 223719.41839995777 std dev: 3474136.2672774503 median: 60200.0 skewness: 101.62734179811766 kurtosis: 12274.018400092675 Clusters basicSize DescriptiveStatistics: n: 99696 min: 1.0 max: 6.0 mean: 2.8916706788637474 std dev: 1.1007889120149232 median: 3.0 skewness: 0.27322452567640465 kurtosis: -0.700049111658736 Top Delta DescriptiveStatistics: n: 99718 min: -33.0 max: 0.0 mean: -0.0019755711105311157 std dev: 0.1942495616723915 median: 0.0 skewness: -116.32793980411823 kurtosis: 15207.602737480422 com.milaboratory.core.alignment.kaligner2.OffsetPacksAccumulatorTest > testScoreCorrection2 SKIPPED com.milaboratory.core.alignment.kaligner2.KAligner2Test > testBoundaries STANDARD_OUT 4967 com.milaboratory.core.alignment.kaligner2.KAligner2Test > caseJ1 STANDARD_OUT 52 0 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGA 51 ||||||||||||||||||||||||||||||||||||||||||||||||||| 55 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGG 106 [S51:A->G] (0->52) (55->107) com.milaboratory.core.alignment.kaligner2.KAligner2Test > testCase0 SKIPPED com.milaboratory.core.alignment.kaligner2.KAligner2Test > testSimpleRandomTest STANDARD_OUT Time per query: 1.18ms Processed queries: 31 Bad percent: 0.0 False positive percent: 0.5921364282330649 Scoring error percent: 0.0 com.milaboratory.core.merger.MergerParametersTest > test2 STANDARD_OUT { "qualityMergingAlgorithm": "SumSubtraction", "partsLayout": "Collinear", "minimalOverlap": 15, "maxQuality": 50, "minimalIdentity": 0.8, "identityType": "Unweighted" } com.milaboratory.core.motif.BitapPatternTest > ttt STANDARD_OUT 0 ATTWCCGACA 9 ||| |||| 20 ATTT--GACA 27 [S3:W->T,D4:C,D5:C] 24 -26 com.milaboratory.core.mutations.MutationTest > exportRegexps STANDARD_OUT S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) com.milaboratory.core.mutations.MutationsTest > testCanonical1 STANDARD_OUT ATATGTTCGGATGTCGCACGCGATTGTCAATTTAATAAACCTGAACGGCGACCGTTAAAAGGTCATTTATTAACAATTAACTGAATGTCCCACTGGAAAAGAGTAGAGTAGTGCTTGGTGAACTCCCGCATGGTGGTTGGTCACCTGAGTCAAGGATTATACTGAGCATACCAGTTATCATCTTAATTACAATTTAGTGCAGCTGTAGCGCCTAGGGTGAAACGCGTCTAAATGGTTTGCGAGAAGGGGGCCCATCAACTCGATGTTGACATAAAAATAGAACCCGCCCGCTCTATGTGATGTTCTACCAACACGTAGAACCCTGCCCATATTACAGCGTATCTCGTTAGCAATCAACACTGCCGAAAAAAACTGAGATAAATTGAACCCCGCATAAAGTTTATCGTAATCTTGGTCCTCTATCTTTAAATATCGTCGGAGGAGAGCGAGAGAAGCAAGCGCGGAGGCGTACCCGCCAGGGGAGTATGCGCTGTCTGCGAGAAGATTGTTTCTGGACGCGTTTA ATGTAGTTGGATGTCGCAGCGATTGTCAATTTAATAAACCTGACGGCGACCGTTAAAGGGTCATTATTAACAATTAACTGAATTCCCACTGGAAGAGAGTCGAGTAGTGCTTGGTGAACTCCCGCATGTGGTTGTCACCGATCAAGGATTATACTGAGCGTACCTGTTATCATCTTATTACAATTTAGTGCAGTGTAGCGCCTAGGGTGAAGACGTCGTCTGAATGGTTTGCGAGAAGGGGGCCCTCACTCGATGTTGACGTAAAAATAGAACCGCCCGTCTATGTAGATGTTCTACCATCACGTAGTACCCTGCCCATATTACGCGTATCTCGTTACAATCATCACTGCGATAAAAACGAGTAAATTGAACCCCGCTAAAGTTTATCGTAATCTTGTCCTCGAGTCTTTAAATATCGTCGGAGGTGAGCGAGAGAACAAGCGCGGAGGCGTACCCGCCAGGGGGAGTATGCGCTTCTGCGAGAAGATTGTTTCTGGACGTGTTA ATGTAGTATGGATGTCGCGCGATTGTCATTTGATAAACCTGACGGCTGACCGTTAGAGGGTCATATATAAACAATTAAACTGAATTCCCACTGAAGAGAGCGAGTAGTGCTTGGTGAACTCCTGCATGTGGTTGTCACCTATTAATGATTATACTGAGACGTACCTGTTATCATCTGTTAGATTTAGTGCAGTGGGCGCCTAGGGTGAAACGTCGTCTGAATGGTTTGCGAGAAGGTGGCCTCACTCGATGTGACGTAAAATAGAACCGCCCGTCTATAGTGGATGTTCTACCACACATAGTACCCTGCCATATCACGCGTATCTCGTTTTACAATCATCACGCGATAAAAACGAGTAAATTAACCCGCTAAGTTTATCGTAGTCTGTCCTCAGTCTTTAAATATCGTCGGAGTTGAGCTAGAGAACCAAGCGCGGAGGCGTACCCGCCGGGGGAAGTATGCGCTCTGCGAGAAGATTGTTTCGGACGTGTTA 0 ATGTAGTAT-GGATGTCG--CGCGATTGTC-ATTTGATAAACCTG-ACGGCTGACCGTTAGAGGGTCATATATAAACAATTAAACTGAAT-TCCCACT-GAAGAGAG-CGAGTAGTGCTTGGTGAACTCCTGCAT-GTGGTT-GTCACCT-A-TTAATGATTATACTGAGACGTACCTGTTATCATC-T-GTTA-GATTTAGTGCAG-TG-GGCGCCTAGGGTGAAACGTCGTCTGAATGGTTTGCGAGAAGGTGG-CC-TC-ACTCGATG-TGACGT-AAAATAGAA-CCGCCCG-TCTATAGTGGATGTTCTACC-ACACATAGTACCCTG-CCATATCAC-GCGTATCTCGTTTTA-CAATCATCAC-G-CGATAAAAAC-GAG-TAAATT-AA-CCCGC-T-AAGTTTATCGTAGTC-T-GTCCTC-AGTCTTTAAATATCGTCGGAGTTGAGCTAGAGAACCAAGCGCGGAGGCGTACCCGCCGGGGGAAGTATGCGC--TCTGCGAGAAGATTGTTTC-GGACGTG-TTA 492 || | || | |||||||| |||||||||| |||| ||||||||| ||||| |||||||| | |||||| ||| ||||||| |||||||| ||||||| ||| |||| ||||||||||||||||||||| |||| |||||| ||||||| | | || |||||||||||| | |||| ||||||||| | ||| ||||||||||| || ||||||||||||||||| ||||| ||||||||||||||||| || || || |||||||| |||| | ||||||||| ||||||| ||||| || ||||||||||| |||| ||| |||||| |||||| || |||||||||| ||| |||||| ||| | ||| |||||| ||| |||||| || ||||| | |||||||||||| || | |||||| | ||||||||||||||||||| |||| |||||| |||||||||||||||||||||| |||| ||||||||| ||||||||||||||||||| ||||| | ||| 0 ATAT-GT-TCGGATGTCGCACGCGATTGTCAATTTAATAAACCTGAACGGC-GACCGTTAAAAGGTCATTTATTAACAATT-AACTGAATGTCCCACTGGAAAAGAGTAGAGTAGTGCTTGGTGAACTCCCGCATGGTGGTTGGTCACCTGAGTCAAGGATTATACTGAG-CATACCAGTTATCATCTTAATTACAATTTAGTGCAGCTGTAGCGCCTAGGGTGAAACG-CGTCTAAATGGTTTGCGAGAAGGGGGCCCATCAACTCGATGTTGACATAAAAATAGAACCCGCCCGCTCTAT-GT-GATGTTCTACCAACACGTAGAACCCTGCCCATATTACAGCGTATCTCG--TTAGCAATCAACACTGCCGAAAAAAACTGAGATAAATTGAACCCCGCATAAAGTTTATCGTAATCTTGGTCCTCTA-TCTTTAAATATCGTCGGAGGAGAGCGAGAGAAGCAAGCGCGGAGGCGTACCCGCCAGGGG-AGTATGCGCTGTCTGCGAGAAGATTGTTTCTGGACGCGTTTA 523 [D6:T,S7:C->T,I8:C,I16:C,I16:A,D17:A,D18:C,I28:A,D29:A,I66:T,D67:T,D70:T,S71:A->T,I73:A,D78:A,I80:A,D145:T,S146:G->T,I147:G,I243:A,D244:A,I272:A,D274:A,I282:C,D283:C,I309:A,D310:A,I325:C,D327:C,D368:A,I371:A,I387:C,D389:C,I395:A,D397:A,I411:T,S412:T->G,D414:G,I491:T,S491:T->G,D492:G] 0 ATATGTTC-GGATGTCG--CACGCGATTGTC-AATTTAATAAACCTGAACGGCGACCGTTAAAAGGTCAT-TTATTAA-CAATTAA-CTGAATGTCCCACTGGAAAAGAGTAGAGTAGTGCTTGGTGAACTCCCGCATGGTGGTTGGTCACCTG-AGTCAAGGATTATACTGAGCATACCAGTTATCATCTTAATTACAATTTAGTGCAGCTGTAGCGCCTAGGGTGAAACGCGTCTAAATGGTTTGCGAG-AAGGGGGCCCATCAACTCGATGTTGACAT-AAAAATAGAA-CCCGCCCGCTCTATGTGATGTTCTACC-AACACGTAGAACCCTG-CCCATATTACAGCGTATCTCGTTAGCAATCAACACTGCCGAAAAAA-ACTGAGATAAATTGAA-CCCCGCAT-AAAGTTTATCGTAATC-TTGGTCCTCTATCTTTAAATATCGTCGGAGGAGAGCGAGAGAAGCAAGCGCGGAGGCGTACCCGCCAGGGGAGTATGCGC-TGTCTGCGAGAAGATTGTTTCTGGACGCGTTTA 523 |||||| |||||||| | ||||||||| | |||||||||||||||||||||||||||||||||||| | || | ||||| | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | ||||||||||||||||||||||||||| || ||||||| | ||||||||||||||||||||||||| | |||||||||||||| || |||||||||||||||||||||||||||||||||||||||| || |||||||||||||||| || ||||| || ||||||||||||| | | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||| 0 ATATGT-TCGGATGTCGCAC--GCGATTGTCAA-TTTAATAAACCTGAACGGCGACCGTTAAAAGGTCATTT-AT-TAACAATT-AACTGAATGTCCCACTGGAAAAGAGTAGAGTAGTGCTTGGTGAACTCCCGCATGGTGGTTGGTCACC-TGAGTCAAGGATTATACTGAGCATACCAGTTATCATCTTAATTACAATTTAGTGCAGCTGTAGCGCCTAGGGTGAAACGCGTCTAAATGGTTTGCGAGAA-GGGGGCCCATCAACTCGATGTTGACATAAA-AATAGAACC-CGCCCGCTCTATGTGATGTTCTACCAA-CACGTAGAACCCTGCCC-ATATTACAGCGTATCTCGTTAGCAATCAACACTGCCGAAA-AAAACTGAGATAAATTGAACCC-CGCATAAA-GTTTATCGTAATCTTGG-TCCTCTATCTTTAAATATCGTCGGAGGAGAGCGAGAGAAGCAAGCGCGGAGGCGTACCCGCCAGGGGAGTATGCGCTG-TCTGCGAGAAGATTGTTTCTGGACGCGTTTA 523 com.milaboratory.core.mutations.MutationsUtilTest > test1111 STANDARD_OUT S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual1 STANDARD_OUT [I2C::SM0I, I2G::I1A, I2C::I1A, SG2C:SM0I:I1A] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual2 STANDARD_OUT [S0:T->N,D13:V,S14:S->Y,S15:P->R,S16:W->P,S17:Y->G,S18:D->T,S19:P->I,S20:G->P,S21:D->A,S22:K->T,S23:A->K,S24:F->R,S25:G->S,S26:P->D,I27:S] [-1, -1, 9, 15] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual3 STANDARD_OUT 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACAAACTATGCACAGAAGCTCCAGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAGCCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGAGAGA 295 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||| ||||| ||||||||||||||||||||||||||||| ||||||||| ||||||||| ||||||||||||||||||| || ||||| ||| || |||||||||||||| 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACATTCTATGCAGAGAAGTTCCAGGGCAGAGTCACCATGACCACAGACGCATCCACGACCACAGCCTATATGGAGCTGAGGAGCCTGACATTTGACG-----GCCACATACTACTGTGCGAGAGA 290 [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] [0, 0, 1, 2, 3, 4, -1, 5, 6, 7, 7, 8, 8, 8, 10, 10, 11, 12] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual4 STANDARD_OUT [S3:S->M,D4:D,S5:_->I] com.milaboratory.core.sequence.AminoAcidAlphabetTest > testCalculateMatches SKIPPED com.milaboratory.core.sequence.AminoAcidSequenceTest > testName STANDARD_OUT 3 com.milaboratory.core.sequence.AminoAcidSequenceTest > testConvertPositionSync1 STANDARD_OUT FromCenter 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromLeftWithoutIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromLeftWithIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromRightWithoutIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromRightWithIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 com.milaboratory.core.sequence.GeneticCodeTest > generateExtendedGeneticCode SKIPPED com.milaboratory.core.sequence.NucleotideAlphabetTest > testCalculateIntersections SKIPPED com.milaboratory.core.sequence.ShortSequenceSetTest > test1 STANDARD_OUT 99955 elements with 365.76KiB in raw nucleotide entropy serialized into 272.51KiB com.milaboratory.core.sequence.quality.QualityAggregatorTest > test1 STANDARD_OUT 45 com.milaboratory.core.sequence.quality.QualityAggregatorTest > test2 STANDARD_OUT 650 com.milaboratory.core.sequence.quality.QualityAggregatorTest > test3 STANDARD_OUT 2535 com.milaboratory.core.sequence.quality.QualityTrimmerTest > testParametersSerialization0 STANDARD_OUT { "averageQualityThreshold": 7.0, "windowSize": 6 } com.milaboratory.core.tree.PrimerGenerator > generate SKIPPED com.milaboratory.core.tree.SequenceTreeMapTest > testCase9 STANDARD_OUT Hit 1 0 ac-gacTtgactg 11 0 acTgac-tgactg 11 Hit 2 0 ac-gactTgactg 11 0 acTgact-gactg 11 com.milaboratory.core.tree.SequenceTreeMapTest > optimalityAndScopeTest STANDARD_OUT --NW alignments-- CASSLAPGATN-KLFF CASS-APGATNEKLFF CASSLAPGATN-KLFF CASSLAPG-TNEKLFF CASSLAPGATN-KLfF CASSLAPG-TNEKLyF --STM alignments-- CASSLAPGATN-KLFF CASS-APGATNEKLFF CASSLAPGATN-KLFF CASSLAPG-TNEKLFF CASSlAPGATN-KLFF CASSa-PGATNEKLFF CASSLAPGaTN-KLFF CASSLAPGt-NEKLFF CASSlAPGATN-KLFF CA-SsAPGATNEKLFF CASSlAPGATN-KLFF CAS-sAPGATNEKLFF CASSLAPGATNk-LFF CASS-APGATNeKLFF CASSLAPGaTN-KLFF CASSLAP-gTNEKLFF CASSLAPGATNk-LFF CASSLAPG-TNeKLFF CASSLAPGATN-KLfF CASSLAPG-TNEKLyF ------------------ com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1nt STANDARD_ERROR Indexing milib_8e941d7dc124f123978f76423d7ed0141b316d4d9284615421360617965.fasta: 0% Indexing milib_8e941d7dc124f123978f76423d7ed0141b316d4d9284615421360617965.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1 STANDARD_ERROR Indexing milib_8e941d7dc124f123978f76423d7ed0141b316d4d9284615421360617965.fasta: 0% Indexing milib_8e941d7dc124f123978f76423d7ed0141b316d4d9284615421360617965.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test2 STANDARD_ERROR Indexing milib_75ae714ca6be16090aeaaf1b4dfd80d47149cf353039965709412280009.tmp: 0% Indexing milib_75ae714ca6be16090aeaaf1b4dfd80d47149cf353039965709412280009.tmp: done com.milaboratory.core.io.util.IOUtilTest > test111 STANDARD_OUT 3 3 -2147483648 -9223372036854775808 com.milaboratory.util.AtomicEnumHistogramTest > test1 STANDARD_OUT {"labels":["A","B","C","null"],"hist":[1,2,0,1]} com.milaboratory.util.ByteStringTest > testSpeed1 STANDARD_OUT Time per hash: 254ns Addition to hash set (per operation): 1.11us Hash set removal (per operation): 855ns a com.milaboratory.util.CacheTest > test1 STANDARD_OUT Cache misses:400 Cache hits:800 com.milaboratory.util.IntCombinationsTest > test1 STANDARD_OUT [0, 1] [0, 2] [1, 2] com.milaboratory.util.JsonOverriderTest > test1 STANDARD_OUT WARNING: unnecessary override -Ob= with the same value. com.milaboratory.util.NSequenceWithQualityPrintHelperTest > test1 SKIPPED com.milaboratory.util.RemoveActionTest > test1 STANDARD_OUT /tmp/milib_837883f5e74295882948ed2b8815e42612cd3fe94929764538439582382 com.milaboratory.util.RemoveActionTest > test2 STANDARD_OUT /tmp/milib_993db645df855a1bba79d28260faac9680bddec92070083920854702937.tmp com.milaboratory.util.sorting.HashSorterTest > testSingleton STANDARD_OUT /tmp/milib_00fabf5252eecae5a453e795e1bfe9a852d1a443913128837291014818 timeInCollate: 5.92s timeInCollatorInit: 4.3s timeAwaitingO: 24.84ms timeAwaitingI: 1.03s timeInFinalSorting1: 0ns timeInFinalSorting2: 202.82ms timeInFinalSorting3: 126.43ms /9S (5|27|32): objs=50000 size=2.97MiB com.milaboratory.util.sorting.HashSorterTest > test1 STANDARD_OUT /tmp/milib_bd05cd3b0dad81853a676dfcfdc5a9909a97ce8f10198713545428365186 timeInCollate: 23.97s timeInCollatorInit: 1.15s timeAwaitingO: 1.55s timeAwaitingI: 6.77s timeInFinalSorting1: 2.14s timeInFinalSorting2: 3.45s timeInFinalSorting3: 642.26ms /0N (5|27|32): objs=163741 size=7.87MiB /1N (5|27|32): objs=143209 size=7MiB /2N (5|27|32): objs=154878 size=7.41MiB /3N (5|27|32): objs=152154 size=7.3MiB /4N (5|27|32): objs=159861 size=7.79MiB /5N (5|27|32): objs=151252 size=7.19MiB /6N (5|27|32): objs=160577 size=7.68MiB /7N (5|27|32): objs=158777 size=7.6MiB /8N (5|27|32): objs=159403 size=7.72MiB /9N (5|27|32): objs=159383 size=7.86MiB /10N (5|27|32): objs=161336 size=8.03MiB /11N (5|27|32): objs=163548 size=8.07MiB /12N (5|27|32): objs=156727 size=7.39MiB /13N (5|27|32): objs=147758 size=7.15MiB /14N (5|27|32): objs=160113 size=7.75MiB /15N (5|27|32): objs=145622 size=6.7MiB /16N (5|27|32): objs=159673 size=7.63MiB /17N (5|27|32): objs=156543 size=7.57MiB /18N (5|27|32): objs=157469 size=7.67MiB /19N (5|27|32): objs=164840 size=7.91MiB /20N (5|27|32): objs=146422 size=6.98MiB /21N (5|27|32): objs=159902 size=7.74MiB /22N (5|27|32): objs=158623 size=7.61MiB /23N (5|27|32): objs=163088 size=8.03MiB /24N (5|27|32): objs=151269 size=7.18MiB /25N (5|27|32): objs=148560 size=7.06MiB /26N (5|27|32): objs=157583 size=7.75MiB /27N (5|27|32): objs=150990 size=7.04MiB /28N (5|27|32): objs=154095 size=7.5MiB /29N (5|27|32): objs=157113 size=7.68MiB /30N (5|27|32): objs=161273 size=7.65MiB /31N (5|27|32): objs=154218 size=7.09MiB /0/0N (2|25|36): objs=42406 size=983.17KiB /0/1N (2|25|36): objs=38476 size=717.2KiB /0/2N (2|25|36): objs=32725 size=592.3KiB /0/3S (2|25|36): objs=164 size=296B /0/4N (2|25|36): objs=6279 size=31.73KiB /0/5S (2|25|36): objs=129 size=254B /0/6N (2|25|36): objs=801 size=3.09KiB /0/7S (2|25|36): objs=153 size=206B /0/8N (2|25|36): objs=1062 size=4.32KiB /0/9S (2|25|36): objs=141 size=85B /0/10N (2|25|36): objs=880 size=3.58KiB /0/11N (2|25|36): objs=283 size=760B /0/12S (2|25|36): objs=156 size=269B /0/13N (2|25|36): objs=322 size=915B /0/14S (2|25|36): objs=128 size=268B /0/15N (2|25|36): objs=1153 size=4.48KiB /0/16S (2|25|36): objs=165 size=209B /0/17N (2|25|36): objs=9475 size=51.74KiB /0/18S (2|25|36): objs=139 size=269B /0/19N (2|25|36): objs=3019 size=12.71KiB /0/20S (2|25|36): objs=175 size=211B /0/21N (2|25|36): objs=4958 size=21.71KiB /0/22S (2|25|36): objs=144 size=116B /0/23N (2|25|36): objs=1086 size=4.42KiB /0/24S (2|25|36): objs=121 size=301B /0/25S (2|25|36): objs=162 size=99B /0/26S (2|25|36): objs=139 size=253B /0/27N (2|25|36): objs=5893 size=25.45KiB /0/28S (2|25|36): objs=168 size=89B /0/29N (2|25|36): objs=4903 size=21.18KiB /0/30S (2|25|36): objs=146 size=292B /0/31N (2|25|36): objs=6513 size=34.25KiB /0/32S (2|25|36): objs=171 size=98B /0/33N (2|25|36): objs=449 size=1.57KiB /0/34S (2|25|36): objs=167 size=105B /0/35N (2|25|36): objs=490 size=1.7KiB /1/0N (1|26|34): objs=66222 size=2.16MiB /1/1N (1|26|34): objs=49284 size=1.35MiB /1/2S (1|26|34): objs=155 size=240B /1/3N (1|26|34): objs=3329 size=14.67KiB /1/4S (1|26|34): objs=169 size=151B /1/5N (1|26|34): objs=1762 size=7.37KiB /1/6S (1|26|34): objs=150 size=333B /1/7N (1|26|34): objs=1822 size=7.85KiB /1/8S (1|26|34): objs=142 size=95B /1/9N (1|26|34): objs=1637 size=6.81KiB /1/10S (1|26|34): objs=130 size=228B /1/12S (1|26|34): objs=143 size=220B /1/13N (1|26|34): objs=604 size=2.15KiB /1/14S (1|26|34): objs=177 size=328B /1/15N (1|26|34): objs=1934 size=7.98KiB /1/16S (1|26|34): objs=143 size=246B /1/17N (1|26|34): objs=1973 size=8.38KiB /1/18S (1|26|34): objs=141 size=324B /1/19N (1|26|34): objs=3663 size=16.81KiB /1/20S (1|26|34): objs=146 size=236B /1/21N (1|26|34): objs=950 size=4.03KiB /1/22S (1|26|34): objs=136 size=320B /1/23N (1|26|34): objs=1088 size=4.29KiB /1/24S (1|26|34): objs=161 size=176B /1/25N (1|26|34): objs=2690 size=11.32KiB /1/26S (1|26|34): objs=163 size=321B /1/27N (1|26|34): objs=1240 size=5.24KiB /1/28S (1|26|34): objs=170 size=202B /1/29N (1|26|34): objs=1624 size=6.52KiB /1/30S (1|26|34): objs=160 size=302B /1/32S (1|26|34): objs=148 size=180B /1/33N (1|26|34): objs=953 size=3.92KiB /2/0N (2|25|36): objs=41276 size=973.56KiB /2/1N (2|25|36): objs=36207 size=584.34KiB /2/2N (2|25|36): objs=39606 size=785.95KiB /2/3N (2|25|36): objs=1653 size=7.39KiB /2/4S (2|25|36): objs=159 size=146B /2/5N (2|25|36): objs=789 size=3.07KiB /2/6S (2|25|36): objs=157 size=262B /2/7N (2|25|36): objs=5429 size=25.99KiB /2/8S (2|25|36): objs=163 size=286B /2/9N (2|25|36): objs=1858 size=7.56KiB /2/10S (2|25|36): objs=148 size=121B /2/11N (2|25|36): objs=1675 size=6.92KiB /2/12S (2|25|36): objs=143 size=183B /2/13S (2|25|36): objs=147 size=271B /2/14S (2|25|36): objs=159 size=221B /2/15N (2|25|36): objs=2474 size=10.2KiB /2/16S (2|25|36): objs=152 size=163B /2/17N (2|25|36): objs=8021 size=39.4KiB /2/18S (2|25|36): objs=138 size=275B /2/19N (2|25|36): objs=1946 size=8.1KiB /2/20S (2|25|36): objs=150 size=208B /2/22S (2|25|36): objs=143 size=155B /2/23N (2|25|36): objs=2130 size=8.79KiB /2/24S (2|25|36): objs=174 size=347B /2/25N (2|25|36): objs=3323 size=15.59KiB /2/26S (2|25|36): objs=152 size=179B /2/27N (2|25|36): objs=1852 size=7.6KiB /2/28S (2|25|36): objs=140 size=253B /2/30S (2|25|36): objs=144 size=330B /2/31N (2|25|36): objs=3200 size=15.37KiB /2/32S (2|25|36): objs=136 size=87B /2/33N (2|25|36): objs=744 size=2.78KiB /2/34S (2|25|36): objs=146 size=131B /2/35S (2|25|36): objs=144 size=212B /3/0N (2|25|36): objs=38108 size=732.89KiB /3/1N (2|25|36): objs=14782 size=105.13KiB /3/2S (2|25|36): objs=151 size=194B /3/3N (2|25|36): objs=22746 size=240.73KiB /3/4N (2|25|36): objs=20263 size=167.94KiB /3/5S (2|25|36): objs=139 size=249B /3/6N (2|25|36): objs=17861 size=105.6KiB /3/7N (2|25|36): objs=4202 size=18.13KiB /3/8S (2|25|36): objs=154 size=259B /3/9N (2|25|36): objs=447 size=1.76KiB /3/10S (2|25|36): objs=145 size=284B /3/11N (2|25|36): objs=3586 size=15.26KiB /3/12S (2|25|36): objs=146 size=127B /3/13N (2|25|36): objs=1088 size=4.33KiB /3/14S (2|25|36): objs=180 size=215B /3/15N (2|25|36): objs=2662 size=11.14KiB /3/16S (2|25|36): objs=154 size=304B /3/18S (2|25|36): objs=137 size=297B /3/19N (2|25|36): objs=3167 size=13.12KiB /3/20S (2|25|36): objs=136 size=228B /3/21N (2|25|36): objs=2604 size=11.14KiB /3/22S (2|25|36): objs=146 size=159B /3/23S (2|25|36): objs=162 size=257B /3/24S (2|25|36): objs=171 size=260B /3/25N (2|25|36): objs=6128 size=28.64KiB /3/26S (2|25|36): objs=151 size=186B /3/27N (2|25|36): objs=301 size=849B /3/28S (2|25|36): objs=151 size=156B /3/29N (2|25|36): objs=1629 size=6.82KiB /3/30S (2|25|36): objs=153 size=252B /3/32S (2|25|36): objs=144 size=285B /3/33N (2|25|36): objs=8504 size=48.37KiB /3/34S (2|25|36): objs=156 size=181B /3/35N (2|25|36): objs=1500 size=6.18KiB /4/0N (2|25|36): objs=39365 size=788.39KiB /4/1N (2|25|36): objs=36912 size=622.61KiB /4/2N (2|25|36): objs=41691 size=933.15KiB /4/3N (2|25|36): objs=4870 size=21.66KiB /4/4S (2|25|36): objs=166 size=179B /4/5N (2|25|36): objs=637 size=2.32KiB /4/6S (2|25|36): objs=164 size=104B /4/7N (2|25|36): objs=1227 size=5.29KiB /4/8S (2|25|36): objs=165 size=261B /4/9N (2|25|36): objs=6051 size=28.58KiB /4/10S (2|25|36): objs=163 size=170B /4/11N (2|25|36): objs=1511 size=6.19KiB /4/12S (2|25|36): objs=137 size=245B /4/13N (2|25|36): objs=4470 size=20.01KiB /4/14S (2|25|36): objs=176 size=146B /4/15N (2|25|36): objs=307 size=1.03KiB /4/16S (2|25|36): objs=171 size=215B /4/17N (2|25|36): objs=2615 size=11.17KiB /4/18S (2|25|36): objs=144 size=321B /4/19N (2|25|36): objs=5654 size=28.67KiB /4/20S (2|25|36): objs=164 size=109B /4/22S (2|25|36): objs=169 size=202B /4/23N (2|25|36): objs=2832 size=12.09KiB /4/24S (2|25|36): objs=163 size=177B /4/25N (2|25|36): objs=1366 size=5.59KiB /4/26S (2|25|36): objs=167 size=313B /4/27N (2|25|36): objs=311 size=1.01KiB /4/28S (2|25|36): objs=149 size=209B /4/29N (2|25|36): objs=396 size=1.35KiB /4/30S (2|25|36): objs=179 size=340B /4/31N (2|25|36): objs=5145 size=25.56KiB /4/32S (2|25|36): objs=139 size=319B /4/33N (2|25|36): objs=1214 size=4.95KiB /4/34S (2|25|36): objs=136 size=141B /4/35N (2|25|36): objs=735 size=2.77KiB /5/0N (2|25|36): objs=35886 size=728.47KiB /5/1N (2|25|36): objs=38174 size=871.5KiB /5/2N (2|25|36): objs=35575 size=624.86KiB /5/3N (2|25|36): objs=4123 size=18.12KiB /5/4S (2|25|36): objs=152 size=116B /5/5N (2|25|36): objs=3017 size=13.27KiB /5/6S (2|25|36): objs=149 size=167B /5/7N (2|25|36): objs=1998 size=8.06KiB /5/8S (2|25|36): objs=142 size=300B /5/9N (2|25|36): objs=1255 size=5.07KiB /5/10S (2|25|36): objs=152 size=128B /5/11N (2|25|36): objs=2416 size=10.22KiB /5/12S (2|25|36): objs=157 size=320B /5/13N (2|25|36): objs=5576 size=26KiB /5/14S (2|25|36): objs=161 size=139B /5/15N (2|25|36): objs=462 size=1.56KiB /5/16S (2|25|36): objs=168 size=286B /5/17N (2|25|36): objs=1704 size=7.33KiB /5/18S (2|25|36): objs=150 size=117B /5/19N (2|25|36): objs=6212 size=29.37KiB /5/20S (2|25|36): objs=144 size=160B /5/21N (2|25|36): objs=1086 size=4.23KiB /5/22S (2|25|36): objs=149 size=243B /5/23N (2|25|36): objs=1781 size=7.35KiB /5/24S (2|25|36): objs=174 size=153B /5/25N (2|25|36): objs=2583 size=10.86KiB /5/26S (2|25|36): objs=161 size=132B /5/27N (2|25|36): objs=3978 size=17.28KiB /5/28S (2|25|36): objs=163 size=184B /5/30S (2|25|36): objs=150 size=253B /5/31N (2|25|36): objs=310 size=983B /5/32S (2|25|36): objs=166 size=238B /5/33N (2|25|36): objs=1208 size=4.88KiB /5/34S (2|25|36): objs=149 size=306B /5/35N (2|25|36): objs=1421 size=5.93KiB /6/0N (2|25|36): objs=38230 size=712.86KiB /6/1N (2|25|36): objs=39136 size=881.45KiB /6/2N (2|25|36): objs=39321 size=731.12KiB /6/3N (2|25|36): objs=15709 size=107.63KiB /6/4S (2|25|36): objs=129 size=217B /6/5N (2|25|36): objs=958 size=3.98KiB /6/6S (2|25|36): objs=165 size=104B /6/7N (2|25|36): objs=284 size=812B /6/8S (2|25|36): objs=162 size=141B /6/9N (2|25|36): objs=1409 size=5.75KiB /6/10S (2|25|36): objs=149 size=204B /6/11N (2|25|36): objs=2285 size=9.79KiB /6/12S (2|25|36): objs=136 size=211B /6/13N (2|25|36): objs=680 size=2.29KiB /6/14S (2|25|36): objs=151 size=206B /6/15N (2|25|36): objs=2188 size=9.39KiB /6/16S (2|25|36): objs=134 size=284B /6/17S (2|25|36): objs=152 size=86B /6/18S (2|25|36): objs=153 size=304B /6/19N (2|25|36): objs=2858 size=11.97KiB /6/20S (2|25|36): objs=163 size=219B /6/21N (2|25|36): objs=1690 size=6.92KiB /6/22S (2|25|36): objs=179 size=339B /6/23N (2|25|36): objs=3689 size=17.03KiB /6/24S (2|25|36): objs=142 size=92B /6/25N (2|25|36): objs=470 size=1.81KiB /6/26S (2|25|36): objs=160 size=148B /6/27N (2|25|36): objs=3957 size=18.87KiB /6/28S (2|25|36): objs=140 size=223B /6/29N (2|25|36): objs=2409 size=10.18KiB /6/30S (2|25|36): objs=147 size=177B /6/31N (2|25|36): objs=2101 size=8.71KiB /6/32S (2|25|36): objs=127 size=151B /6/33N (2|25|36): objs=300 size=965B /6/34S (2|25|36): objs=161 size=177B /6/35N (2|25|36): objs=353 size=1.16KiB /7/0N (2|25|36): objs=40392 size=892KiB /7/1N (2|25|36): objs=42325 size=963.38KiB /7/2N (2|25|36): objs=37703 size=776.22KiB /7/3S (2|25|36): objs=149 size=108B /7/5S (2|25|36): objs=164 size=100B /7/6S (2|25|36): objs=157 size=300B /7/7N (2|25|36): objs=322 size=918B /7/8S (2|25|36): objs=148 size=242B /7/9N (2|25|36): objs=3109 size=13.03KiB /7/10S (2|25|36): objs=149 size=287B /7/12S (2|25|36): objs=160 size=178B /7/13S (2|25|36): objs=158 size=181B /7/14S (2|25|36): objs=160 size=324B /7/15N (2|25|36): objs=5901 size=27.95KiB /7/16S (2|25|36): objs=160 size=227B /7/17N (2|25|36): objs=750 size=2.81KiB /7/18S (2|25|36): objs=160 size=287B /7/19N (2|25|36): objs=5245 size=24KiB /7/20S (2|25|36): objs=153 size=271B /7/21N (2|25|36): objs=2156 size=9.02KiB /7/22S (2|25|36): objs=167 size=329B /7/24S (2|25|36): objs=158 size=205B /7/25N (2|25|36): objs=4255 size=19.38KiB /7/26S (2|25|36): objs=177 size=349B /7/27N (2|25|36): objs=4125 size=17.76KiB /7/28S (2|25|36): objs=153 size=298B /7/29N (2|25|36): objs=4008 size=17.58KiB /7/30S (2|25|36): objs=194 size=128B /7/31N (2|25|36): objs=633 size=2.35KiB /7/32S (2|25|36): objs=158 size=199B /7/33N (2|25|36): objs=1439 size=5.8KiB /7/34S (2|25|36): objs=151 size=104B /7/35N (2|25|36): objs=3538 size=15.03KiB /8/0N (2|25|36): objs=39827 size=764.22KiB /8/1N (2|25|36): objs=40485 size=892.95KiB /8/2N (2|25|36): objs=35121 size=669.21KiB /8/3N (2|25|36): objs=3378 size=14.83KiB /8/4S (2|25|36): objs=148 size=125B /8/5N (2|25|36): objs=4237 size=18.69KiB /8/6S (2|25|36): objs=133 size=308B /8/7N (2|25|36): objs=588 size=2.03KiB /8/8S (2|25|36): objs=157 size=224B /8/9N (2|25|36): objs=3337 size=15.41KiB /8/10S (2|25|36): objs=168 size=228B /8/11N (2|25|36): objs=309 size=907B /8/12S (2|25|36): objs=169 size=150B /8/13N (2|25|36): objs=1553 size=6.3KiB /8/14S (2|25|36): objs=142 size=139B /8/15N (2|25|36): objs=1077 size=4.17KiB /8/16S (2|25|36): objs=163 size=293B /8/17N (2|25|36): objs=4135 size=19.79KiB /8/18S (2|25|36): objs=132 size=266B /8/19N (2|25|36): objs=289 size=818B /8/20S (2|25|36): objs=162 size=179B /8/21N (2|25|36): objs=4339 size=18.44KiB /8/22S (2|25|36): objs=162 size=339B /8/23N (2|25|36): objs=3359 size=14.21KiB /8/24S (2|25|36): objs=166 size=218B /8/25N (2|25|36): objs=1382 size=5.39KiB /8/26S (2|25|36): objs=143 size=189B /8/27N (2|25|36): objs=3623 size=16.68KiB /8/28S (2|25|36): objs=167 size=248B /8/29S (2|25|36): objs=160 size=123B /8/30S (2|25|36): objs=153 size=309B /8/31N (2|25|36): objs=6573 size=28.98KiB /8/32S (2|25|36): objs=143 size=326B /8/33N (2|25|36): objs=2696 size=11.62KiB /8/34S (2|25|36): objs=167 size=225B /8/35N (2|25|36): objs=460 size=1.51KiB /9/0N (2|25|36): objs=20843 size=195.25KiB /9/1S (2|25|36): objs=145 size=176B /9/2N (2|25|36): objs=17505 size=124.9KiB /9/3N (2|25|36): objs=42302 size=1.05MiB /9/4N (2|25|36): objs=12364 size=69.98KiB /9/5S (2|25|36): objs=183 size=179B /9/6N (2|25|36): objs=753 size=2.84KiB /9/7S (2|25|36): objs=157 size=239B /9/8N (2|25|36): objs=2782 size=14.01KiB /9/9S (2|25|36): objs=153 size=162B /9/10N (2|25|36): objs=907 size=3.54KiB /9/11S (2|25|36): objs=135 size=128B /9/12N (2|25|36): objs=2871 size=12.17KiB /9/13S (2|25|36): objs=148 size=264B /9/14N (2|25|36): objs=1459 size=5.91KiB /9/15S (2|25|36): objs=169 size=207B /9/16N (2|25|36): objs=8451 size=46.63KiB /9/17S (2|25|36): objs=168 size=237B /9/18S (2|25|36): objs=136 size=293B /9/19S (2|25|36): objs=148 size=143B /9/20N (2|25|36): objs=2217 size=9.44KiB /9/21S (2|25|36): objs=158 size=99B /9/22N (2|25|36): objs=6083 size=27.7KiB /9/23S (2|25|36): objs=153 size=123B /9/25S (2|25|36): objs=135 size=297B /9/26N (2|25|36): objs=462 size=1.63KiB /9/28S (2|25|36): objs=162 size=306B /9/29N (2|25|36): objs=7581 size=35.8KiB /9/30S (2|25|36): objs=145 size=271B /9/31N (2|25|36): objs=20392 size=183KiB /9/32S (2|25|36): objs=149 size=268B /9/33N (2|25|36): objs=9659 size=56.94KiB /9/34S (2|25|36): objs=156 size=139B /9/35S (2|25|36): objs=152 size=145B /10/0N (2|25|36): objs=40912 size=970.66KiB /10/1N (2|25|36): objs=43061 size=1016.64KiB /10/2N (2|25|36): objs=28099 size=399.28KiB /10/3S (2|25|36): objs=147 size=295B /10/4N (2|25|36): objs=9834 size=56.25KiB /10/5S (2|25|36): objs=137 size=183B /10/6N (2|25|36): objs=3077 size=13.16KiB /10/7N (2|25|36): objs=4537 size=22.62KiB /10/8S (2|25|36): objs=155 size=257B /10/9N (2|25|36): objs=2709 size=11.92KiB /10/10S (2|25|36): objs=128 size=312B /10/11N (2|25|36): objs=3241 size=14.94KiB /10/12S (2|25|36): objs=149 size=159B /10/13N (2|25|36): objs=2207 size=9.3KiB /10/14S (2|25|36): objs=153 size=227B /10/15N (2|25|36): objs=321 size=732B /10/16S (2|25|36): objs=150 size=255B /10/17N (2|25|36): objs=751 size=2.86KiB /10/18S (2|25|36): objs=142 size=175B /10/19N (2|25|36): objs=4597 size=21.38KiB /10/20S (2|25|36): objs=144 size=211B /10/21N (2|25|36): objs=1108 size=4.54KiB /10/22S (2|25|36): objs=163 size=247B /10/23N (2|25|36): objs=3129 size=12.98KiB /10/24S (2|25|36): objs=163 size=309B /10/25N (2|25|36): objs=1383 size=5.62KiB /10/26S (2|25|36): objs=150 size=155B /10/27S (2|25|36): objs=170 size=122B /10/28S (2|25|36): objs=166 size=284B /10/29N (2|25|36): objs=4478 size=21.52KiB /10/30S (2|25|36): objs=143 size=266B /10/31N (2|25|36): objs=2223 size=9.44KiB /10/32S (2|25|36): objs=152 size=167B /10/33N (2|25|36): objs=1096 size=4.23KiB /10/34S (2|25|36): objs=175 size=168B /10/35N (2|25|36): objs=1986 size=8.3KiB /11/0N (2|25|36): objs=41149 size=858.09KiB /11/1N (2|25|36): objs=45620 size=1.18MiB /11/2N (2|25|36): objs=41820 size=964.41KiB /11/3N (2|25|36): objs=11648 size=62.52KiB /11/4S (2|25|36): objs=156 size=95B /11/5N (2|25|36): objs=2792 size=12KiB /11/6S (2|25|36): objs=145 size=161B /11/7N (2|25|36): objs=429 size=1.38KiB /11/8S (2|25|36): objs=158 size=147B /11/9N (2|25|36): objs=3713 size=15.98KiB /11/10S (2|25|36): objs=151 size=267B /11/11N (2|25|36): objs=787 size=2.89KiB /11/12S (2|25|36): objs=150 size=218B /11/13N (2|25|36): objs=619 size=2.15KiB /11/14S (2|25|36): objs=149 size=87B /11/15N (2|25|36): objs=1433 size=5.97KiB /11/16S (2|25|36): objs=163 size=235B /11/18S (2|25|36): objs=160 size=112B /11/19N (2|25|36): objs=631 size=2.2KiB /11/20S (2|25|36): objs=137 size=105B /11/21N (2|25|36): objs=952 size=3.85KiB /11/22S (2|25|36): objs=161 size=236B /11/23N (2|25|36): objs=1180 size=4.89KiB /11/24S (2|25|36): objs=147 size=281B /11/25N (2|25|36): objs=3358 size=15.51KiB /11/26S (2|25|36): objs=138 size=294B /11/27N (2|25|36): objs=452 size=1.51KiB /11/28S (2|25|36): objs=141 size=177B /11/29N (2|25|36): objs=319 size=987B /11/30S (2|25|36): objs=159 size=159B /11/31S (2|25|36): objs=143 size=240B /11/32S (2|25|36): objs=147 size=139B /11/33N (2|25|36): objs=1569 size=6.3KiB /11/34S (2|25|36): objs=150 size=150B /11/35N (2|25|36): objs=2522 size=10.69KiB /12/0N (2|25|36): objs=43432 size=871.45KiB /12/1N (2|25|36): objs=36994 size=753.33KiB /12/2N (2|25|36): objs=34174 size=520.28KiB /12/3N (2|25|36): objs=21815 size=186.15KiB /12/4S (2|25|36): objs=149 size=312B /12/5N (2|25|36): objs=2590 size=10.91KiB /12/6S (2|25|36): objs=130 size=244B /12/7N (2|25|36): objs=315 size=897B /12/8S (2|25|36): objs=177 size=278B /12/10S (2|25|36): objs=160 size=139B /12/11S (2|25|36): objs=152 size=262B /12/12S (2|25|36): objs=151 size=188B /12/13N (2|25|36): objs=2292 size=9.93KiB /12/14S (2|25|36): objs=149 size=292B /12/16S (2|25|36): objs=158 size=247B /12/17S (2|25|36): objs=145 size=192B /12/18S (2|25|36): objs=151 size=209B /12/19N (2|25|36): objs=4352 size=18.53KiB /12/20S (2|25|36): objs=171 size=137B /12/21N (2|25|36): objs=1281 size=5.02KiB /12/22S (2|25|36): objs=131 size=227B /12/24S (2|25|36): objs=143 size=274B /12/25N (2|25|36): objs=630 size=2.16KiB /12/26S (2|25|36): objs=169 size=363B /12/27N (2|25|36): objs=923 size=3.68KiB /12/28S (2|25|36): objs=158 size=151B /12/29N (2|25|36): objs=904 size=3.31KiB /12/30S (2|25|36): objs=157 size=265B /12/32S (2|25|36): objs=146 size=152B /12/33N (2|25|36): objs=2553 size=10.66KiB /12/34S (2|25|36): objs=164 size=302B /12/35N (2|25|36): objs=1711 size=7.07KiB /13/0N (2|25|36): objs=37763 size=744.51KiB /13/1N (2|25|36): objs=40033 size=914.15KiB /13/2N (2|25|36): objs=37355 size=699.21KiB /13/4S (2|25|36): objs=143 size=124B /13/5N (2|25|36): objs=4046 size=18.89KiB /13/6S (2|25|36): objs=167 size=128B /13/7N (2|25|36): objs=1700 size=7.03KiB /13/8S (2|25|36): objs=144 size=258B /13/9N (2|25|36): objs=1805 size=7.44KiB /13/10S (2|25|36): objs=173 size=103B /13/11N (2|25|36): objs=2136 size=8.83KiB /13/12S (2|25|36): objs=128 size=288B /13/13N (2|25|36): objs=3108 size=14.62KiB /13/14S (2|25|36): objs=168 size=103B /13/15N (2|25|36): objs=2756 size=12.24KiB /13/16S (2|25|36): objs=143 size=246B /13/17N (2|25|36): objs=3803 size=17.68KiB /13/18S (2|25|36): objs=141 size=166B /13/19N (2|25|36): objs=2504 size=10.63KiB /13/20S (2|25|36): objs=154 size=120B /13/21N (2|25|36): objs=644 size=2.56KiB /13/22S (2|25|36): objs=134 size=86B /13/23N (2|25|36): objs=2739 size=11.72KiB /13/24S (2|25|36): objs=136 size=178B /13/25N (2|25|36): objs=2419 size=10.33KiB /13/26S (2|25|36): objs=173 size=234B /13/27S (2|25|36): objs=146 size=281B /13/28S (2|25|36): objs=139 size=102B /13/29N (2|25|36): objs=321 size=1.01KiB /13/30S (2|25|36): objs=148 size=176B /13/31N (2|25|36): objs=436 size=1.6KiB /13/32S (2|25|36): objs=142 size=112B /13/33N (2|25|36): objs=1212 size=4.99KiB /13/34S (2|25|36): objs=156 size=278B /13/35N (2|25|36): objs=443 size=1.49KiB /14/0N (2|25|36): objs=41510 size=906.47KiB /14/1N (2|25|36): objs=37783 size=729.65KiB /14/2N (2|25|36): objs=16791 size=115.41KiB /14/3S (2|25|36): objs=184 size=358B /14/4N (2|25|36): objs=24447 size=327.68KiB /14/5S (2|25|36): objs=132 size=245B /14/6N (2|25|36): objs=2139 size=8.62KiB /14/7N (2|25|36): objs=340 size=1.12KiB /14/8S (2|25|36): objs=162 size=278B /14/9S (2|25|36): objs=174 size=122B /14/10S (2|25|36): objs=152 size=320B /14/11N (2|25|36): objs=3231 size=13.63KiB /14/12S (2|25|36): objs=151 size=146B /14/13N (2|25|36): objs=2260 size=9.35KiB /14/14S (2|25|36): objs=137 size=205B /14/15N (2|25|36): objs=615 size=2.28KiB /14/16S (2|25|36): objs=158 size=259B /14/17N (2|25|36): objs=1826 size=7.49KiB /14/18S (2|25|36): objs=132 size=113B /14/19N (2|25|36): objs=8497 size=45.73KiB /14/20S (2|25|36): objs=161 size=207B /14/21N (2|25|36): objs=768 size=2.91KiB /14/22S (2|25|36): objs=146 size=228B /14/23N (2|25|36): objs=791 size=2.98KiB /14/24S (2|25|36): objs=148 size=308B /14/25N (2|25|36): objs=1580 size=6.75KiB /14/26S (2|25|36): objs=155 size=331B /14/27N (2|25|36): objs=779 size=2.79KiB /14/28S (2|25|36): objs=169 size=311B /14/29N (2|25|36): objs=3650 size=16.69KiB /14/30S (2|25|36): objs=158 size=289B /14/31N (2|25|36): objs=2581 size=10.99KiB /14/32S (2|25|36): objs=147 size=156B /14/33N (2|25|36): objs=1988 size=8.36KiB /14/34S (2|25|36): objs=158 size=197B /14/35N (2|25|36): objs=5913 size=27.59KiB /15/0N (2|25|36): objs=37419 size=674.53KiB /15/1N (2|25|36): objs=37093 size=727.04KiB /15/2N (2|25|36): objs=6739 size=30.51KiB /15/3S (2|25|36): objs=172 size=282B /15/4N (2|25|36): objs=30598 size=438.58KiB /15/5S (2|25|36): objs=136 size=283B /15/7N (2|25|36): objs=307 size=874B /15/8S (2|25|36): objs=156 size=115B /15/9S (2|25|36): objs=132 size=315B /15/10S (2|25|36): objs=159 size=235B /15/11S (2|25|36): objs=146 size=211B /15/12S (2|25|36): objs=149 size=250B /15/13N (2|25|36): objs=1130 size=4.38KiB /15/14S (2|25|36): objs=139 size=299B /15/15N (2|25|36): objs=1709 size=6.96KiB /15/16S (2|25|36): objs=146 size=119B /15/17N (2|25|36): objs=5536 size=26.99KiB /15/18S (2|25|36): objs=162 size=329B /15/20S (2|25|36): objs=155 size=185B /15/21N (2|25|36): objs=1973 size=7.9KiB /15/22S (2|25|36): objs=167 size=266B /15/23N (2|25|36): objs=3890 size=17.9KiB /15/24S (2|25|36): objs=151 size=307B /15/25N (2|25|36): objs=3135 size=13.22KiB /15/26S (2|25|36): objs=153 size=239B /15/27N (2|25|36): objs=2555 size=11.53KiB /15/28S (2|25|36): objs=155 size=280B /15/29N (2|25|36): objs=2786 size=12.02KiB /15/30S (2|25|36): objs=163 size=200B /15/31N (2|25|36): objs=1692 size=6.94KiB /15/32S (2|25|36): objs=168 size=208B /15/33N (2|25|36): objs=5894 size=27.37KiB /15/34S (2|25|36): objs=152 size=256B /15/35N (2|25|36): objs=405 size=1.5KiB /16/0N (2|25|36): objs=37026 size=805.27KiB /16/1N (2|25|36): objs=38537 size=702.97KiB /16/2N (2|25|36): objs=39302 size=841.95KiB /16/3S (2|25|36): objs=162 size=188B /16/4S (2|25|36): objs=148 size=125B /16/5S (2|25|36): objs=142 size=311B /16/7S (2|25|36): objs=157 size=210B /16/8N (2|25|36): objs=2128 size=8.65KiB /16/9S (2|25|36): objs=140 size=142B /16/10N (2|25|36): objs=307 size=804B /16/11N (2|25|36): objs=5580 size=27.27KiB /16/12S (2|25|36): objs=139 size=201B /16/13N (2|25|36): objs=5458 size=23.6KiB /16/14S (2|25|36): objs=151 size=199B /16/15N (2|25|36): objs=929 size=3.79KiB /16/16S (2|25|36): objs=156 size=226B /16/17N (2|25|36): objs=6722 size=32.96KiB /16/18S (2|25|36): objs=145 size=286B /16/19N (2|25|36): objs=4261 size=19.75KiB /16/20S (2|25|36): objs=159 size=113B /16/21N (2|25|36): objs=1090 size=4.12KiB /16/22S (2|25|36): objs=154 size=126B /16/23N (2|25|36): objs=763 size=2.94KiB /16/24S (2|25|36): objs=148 size=136B /16/25N (2|25|36): objs=2025 size=8.51KiB /16/26S (2|25|36): objs=168 size=339B /16/27N (2|25|36): objs=3001 size=15.18KiB /16/28S (2|25|36): objs=156 size=110B /16/29N (2|25|36): objs=1545 size=6.32KiB /16/30S (2|25|36): objs=135 size=129B /16/31N (2|25|36): objs=4371 size=19.01KiB /16/32S (2|25|36): objs=165 size=304B /16/33N (2|25|36): objs=2146 size=8.76KiB /16/34S (2|25|36): objs=147 size=299B /16/35N (2|25|36): objs=1910 size=7.99KiB /17/0N (2|25|36): objs=39337 size=914.24KiB /17/1N (2|25|36): objs=37572 size=776.75KiB /17/2N (2|25|36): objs=24197 size=256.69KiB /17/3S (2|25|36): objs=162 size=343B /17/4N (2|25|36): objs=14841 size=98.41KiB /17/5N (2|25|36): objs=5648 size=25.44KiB /17/6S (2|25|36): objs=155 size=193B /17/7N (2|25|36): objs=1732 size=7.04KiB /17/8S (2|25|36): objs=170 size=352B /17/9N (2|25|36): objs=1202 size=4.81KiB /17/10S (2|25|36): objs=137 size=217B /17/11N (2|25|36): objs=2615 size=11.25KiB /17/12S (2|25|36): objs=151 size=189B /17/13N (2|25|36): objs=4938 size=22.18KiB /17/14S (2|25|36): objs=176 size=280B /17/15N (2|25|36): objs=5911 size=30.36KiB /17/16S (2|25|36): objs=144 size=172B /17/17N (2|25|36): objs=769 size=2.88KiB /17/18S (2|25|36): objs=170 size=240B /17/19N (2|25|36): objs=1486 size=6.15KiB /17/20S (2|25|36): objs=141 size=154B /17/21N (2|25|36): objs=482 size=1.57KiB /17/22S (2|25|36): objs=143 size=302B /17/23N (2|25|36): objs=952 size=3.8KiB /17/24S (2|25|36): objs=155 size=301B /17/25S (2|25|36): objs=185 size=121B /17/26S (2|25|36): objs=144 size=163B /17/27N (2|25|36): objs=1406 size=5.67KiB /17/28S (2|25|36): objs=160 size=177B /17/29N (2|25|36): objs=1355 size=5.43KiB /17/30S (2|25|36): objs=146 size=161B /17/31N (2|25|36): objs=5485 size=24.85KiB /17/32S (2|25|36): objs=173 size=150B /17/33N (2|25|36): objs=1029 size=3.83KiB /17/34S (2|25|36): objs=172 size=158B /17/35N (2|25|36): objs=2902 size=12.68KiB /18/0N (2|25|36): objs=35408 size=666.81KiB /18/1N (2|25|36): objs=36301 size=687.01KiB /18/2N (2|25|36): objs=40533 size=881.91KiB /18/3N (2|25|36): objs=8098 size=45.16KiB /18/4S (2|25|36): objs=171 size=234B /18/5N (2|25|36): objs=7417 size=37.28KiB /18/6S (2|25|36): objs=142 size=158B /18/7N (2|25|36): objs=3176 size=14.04KiB /18/8S (2|25|36): objs=146 size=139B /18/9N (2|25|36): objs=3858 size=16.4KiB /18/10S (2|25|36): objs=139 size=221B /18/11N (2|25|36): objs=1354 size=5.64KiB /18/12S (2|25|36): objs=175 size=200B /18/13N (2|25|36): objs=314 size=928B /18/14S (2|25|36): objs=156 size=158B /18/15N (2|25|36): objs=1498 size=6.29KiB /18/16S (2|25|36): objs=154 size=149B /18/17N (2|25|36): objs=732 size=2.88KiB /18/18S (2|25|36): objs=147 size=301B /18/19N (2|25|36): objs=1188 size=4.83KiB /18/20S (2|25|36): objs=159 size=109B /18/21N (2|25|36): objs=438 size=1.5KiB /18/22S (2|25|36): objs=165 size=152B /18/23N (2|25|36): objs=2430 size=10.06KiB /18/24S (2|25|36): objs=168 size=326B /18/25N (2|25|36): objs=1246 size=5.21KiB /18/26S (2|25|36): objs=181 size=316B /18/27N (2|25|36): objs=3825 size=16.41KiB /18/28S (2|25|36): objs=144 size=183B /18/29N (2|25|36): objs=3977 size=18.8KiB /18/30S (2|25|36): objs=164 size=165B /18/32S (2|25|36): objs=155 size=196B /18/33N (2|25|36): objs=1745 size=6.91KiB /18/34S (2|25|36): objs=142 size=129B /18/35N (2|25|36): objs=1423 size=5.79KiB /19/0N (2|25|36): objs=42009 size=969.34KiB /19/1N (2|25|36): objs=42771 size=866.96KiB /19/2N (2|25|36): objs=40998 size=938.5KiB /19/3N (2|25|36): objs=3703 size=15.31KiB /19/4S (2|25|36): objs=158 size=115B /19/5N (2|25|36): objs=4305 size=18.92KiB /19/6S (2|25|36): objs=152 size=213B /19/7N (2|25|36): objs=5695 size=26.58KiB /19/8S (2|25|36): objs=170 size=103B /19/9N (2|25|36): objs=616 size=2.17KiB /19/10S (2|25|36): objs=160 size=204B /19/11N (2|25|36): objs=1371 size=5.57KiB /19/12S (2|25|36): objs=138 size=115B /19/13N (2|25|36): objs=1585 size=6.51KiB /19/14S (2|25|36): objs=156 size=108B /19/15N (2|25|36): objs=1134 size=4.53KiB /19/16S (2|25|36): objs=145 size=346B /19/17N (2|25|36): objs=1071 size=4.09KiB /19/18S (2|25|36): objs=158 size=318B /19/19N (2|25|36): objs=1713 size=6.9KiB /19/20S (2|25|36): objs=162 size=146B /19/21N (2|25|36): objs=2751 size=11.51KiB /19/22S (2|25|36): objs=159 size=221B /19/23N (2|25|36): objs=2791 size=11.62KiB /19/24S (2|25|36): objs=165 size=269B /19/25N (2|25|36): objs=1841 size=7.65KiB /19/26S (2|25|36): objs=156 size=273B /19/27N (2|25|36): objs=1976 size=8.08KiB /19/28S (2|25|36): objs=150 size=198B /19/29N (2|25|36): objs=793 size=2.96KiB /19/30S (2|25|36): objs=166 size=227B /19/31N (2|25|36): objs=462 size=1.53KiB /19/32S (2|25|36): objs=160 size=118B /19/33N (2|25|36): objs=455 size=1.69KiB /19/34S (2|25|36): objs=141 size=311B /19/35N (2|25|36): objs=4304 size=21.96KiB /20/0N (2|25|36): objs=37773 size=764.61KiB /20/1N (2|25|36): objs=33568 size=535.15KiB /20/2N (2|25|36): objs=34465 size=708.05KiB /20/3N (2|25|36): objs=2350 size=9.87KiB /20/4S (2|25|36): objs=142 size=120B /20/5N (2|25|36): objs=1709 size=7.18KiB /20/6S (2|25|36): objs=133 size=290B /20/7N (2|25|36): objs=7871 size=39.34KiB /20/8S (2|25|36): objs=148 size=139B /20/9N (2|25|36): objs=4963 size=24.63KiB /20/10S (2|25|36): objs=143 size=110B /20/11N (2|25|36): objs=587 size=2.24KiB /20/12S (2|25|36): objs=172 size=270B /20/13N (2|25|36): objs=7403 size=36.59KiB /20/14S (2|25|36): objs=155 size=86B /20/15N (2|25|36): objs=467 size=1.62KiB /20/16S (2|25|36): objs=150 size=246B /20/18S (2|25|36): objs=139 size=254B /20/19N (2|25|36): objs=603 size=2.2KiB /20/20S (2|25|36): objs=135 size=119B /20/21N (2|25|36): objs=1100 size=4.5KiB /20/22S (2|25|36): objs=144 size=233B /20/23N (2|25|36): objs=589 size=1.95KiB /20/24S (2|25|36): objs=149 size=250B /20/26S (2|25|36): objs=148 size=144B /20/27S (2|25|36): objs=153 size=205B /20/28S (2|25|36): objs=148 size=268B /20/29N (2|25|36): objs=5425 size=27.09KiB /20/30S (2|25|36): objs=164 size=292B /20/31N (2|25|36): objs=2308 size=9.54KiB /20/32S (2|25|36): objs=132 size=302B /20/33N (2|25|36): objs=442 size=1.52KiB /20/34S (2|25|36): objs=149 size=335B /20/35N (2|25|36): objs=2295 size=9.5KiB /21/0N (2|25|36): objs=40188 size=872.79KiB /21/1N (2|25|36): objs=41883 size=893.1KiB /21/2N (2|25|36): objs=31988 size=499.68KiB /21/3S (2|25|36): objs=164 size=304B /21/4N (2|25|36): objs=3919 size=18.57KiB /21/5S (2|25|36): objs=138 size=195B /21/6N (2|25|36): objs=1523 size=6.38KiB /21/7S (2|25|36): objs=136 size=139B /21/8N (2|25|36): objs=4585 size=22.9KiB /21/9N (2|25|36): objs=1562 size=6.21KiB /21/10S (2|25|36): objs=166 size=291B /21/11N (2|25|36): objs=6586 size=32.01KiB /21/12S (2|25|36): objs=132 size=257B /21/13N (2|25|36): objs=5099 size=23.13KiB /21/14S (2|25|36): objs=153 size=259B /21/15N (2|25|36): objs=1383 size=5.62KiB /21/16S (2|25|36): objs=126 size=292B /21/17N (2|25|36): objs=4309 size=19.74KiB /21/18S (2|25|36): objs=127 size=145B /21/19N (2|25|36): objs=3658 size=16.05KiB /21/20S (2|25|36): objs=153 size=163B /21/21N (2|25|36): objs=1204 size=4.79KiB /21/22S (2|25|36): objs=176 size=311B /21/23N (2|25|36): objs=1940 size=8.19KiB /21/24S (2|25|36): objs=132 size=302B /21/25N (2|25|36): objs=2622 size=12.28KiB /21/26S (2|25|36): objs=162 size=237B /21/27N (2|25|36): objs=1226 size=4.92KiB /21/28S (2|25|36): objs=132 size=166B /21/29N (2|25|36): objs=1041 size=4.09KiB /21/30S (2|25|36): objs=164 size=269B /21/31N (2|25|36): objs=586 size=2.33KiB /21/32S (2|25|36): objs=150 size=262B /21/33N (2|25|36): objs=2251 size=9.25KiB /21/34S (2|25|36): objs=138 size=214B /22/0N (2|25|36): objs=37464 size=714.71KiB /22/1N (2|25|36): objs=38383 size=709.05KiB /22/2N (2|25|36): objs=39228 size=813.64KiB /22/3N (2|25|36): objs=7652 size=38.86KiB /22/4S (2|25|36): objs=161 size=280B /22/5S (2|25|36): objs=167 size=283B /22/6S (2|25|36): objs=152 size=302B /22/8S (2|25|36): objs=155 size=128B /22/9N (2|25|36): objs=1588 size=6.55KiB /22/10S (2|25|36): objs=163 size=323B /22/11N (2|25|36): objs=3587 size=15.93KiB /22/12S (2|25|36): objs=148 size=234B /22/13N (2|25|36): objs=872 size=3.56KiB /22/14S (2|25|36): objs=161 size=262B /22/15N (2|25|36): objs=755 size=2.92KiB /22/16S (2|25|36): objs=143 size=297B /22/18S (2|25|36): objs=163 size=144B /22/19N (2|25|36): objs=6844 size=31.53KiB /22/20S (2|25|36): objs=157 size=138B /22/21N (2|25|36): objs=4091 size=19.83KiB /22/22S (2|25|36): objs=152 size=284B /22/23N (2|25|36): objs=1517 size=6.49KiB /22/24S (2|25|36): objs=146 size=262B /22/25N (2|25|36): objs=3228 size=13.72KiB /22/26S (2|25|36): objs=155 size=89B /22/27N (2|25|36): objs=312 size=894B /22/28S (2|25|36): objs=159 size=225B /22/29N (2|25|36): objs=469 size=1.78KiB /22/30S (2|25|36): objs=178 size=137B /22/31N (2|25|36): objs=332 size=1.07KiB /22/32S (2|25|36): objs=161 size=215B /22/33N (2|25|36): objs=8073 size=42.79KiB /22/34S (2|25|36): objs=138 size=298B /22/35N (2|25|36): objs=1569 size=6.39KiB /23/0N (2|25|36): objs=38348 size=877.41KiB /23/1N (2|25|36): objs=37083 size=690.71KiB /23/2N (2|25|36): objs=41391 size=902.49KiB /23/3N (2|25|36): objs=7147 size=32.03KiB /23/4S (2|25|36): objs=159 size=175B /23/5N (2|25|36): objs=483 size=1.46KiB /23/6S (2|25|36): objs=143 size=317B /23/7N (2|25|36): objs=3326 size=15.46KiB /23/8S (2|25|36): objs=153 size=234B /23/9N (2|25|36): objs=4970 size=21.16KiB /23/10S (2|25|36): objs=168 size=319B /23/12S (2|25|36): objs=148 size=154B /23/13N (2|25|36): objs=6831 size=34.35KiB /23/14S (2|25|36): objs=144 size=303B /23/15N (2|25|36): objs=1542 size=6.34KiB /23/16S (2|25|36): objs=160 size=317B /23/17N (2|25|36): objs=4859 size=23.73KiB /23/18S (2|25|36): objs=170 size=353B /23/19S (2|25|36): objs=148 size=99B /23/20S (2|25|36): objs=185 size=248B /23/22S (2|25|36): objs=133 size=116B /23/23N (2|25|36): objs=2304 size=9.63KiB /23/24S (2|25|36): objs=169 size=97B /23/25N (2|25|36): objs=1343 size=5.52KiB /23/26S (2|25|36): objs=152 size=212B /23/27N (2|25|36): objs=619 size=2.3KiB /23/28S (2|25|36): objs=135 size=198B /23/29N (2|25|36): objs=999 size=3.93KiB /23/30S (2|25|36): objs=158 size=308B /23/31N (2|25|36): objs=7675 size=40.18KiB /23/32S (2|25|36): objs=145 size=111B /23/33N (2|25|36): objs=796 size=2.92KiB /23/34S (2|25|36): objs=153 size=158B /23/35N (2|25|36): objs=749 size=3.03KiB /24/0N (2|25|36): objs=37909 size=646.18KiB /24/1N (2|25|36): objs=34640 size=673.79KiB /24/2N (2|25|36): objs=39902 size=797.28KiB /24/3N (2|25|36): objs=1788 size=7.46KiB /24/4S (2|25|36): objs=136 size=241B /24/6S (2|25|36): objs=151 size=262B /24/8S (2|25|36): objs=170 size=195B /24/9N (2|25|36): objs=3978 size=18.28KiB /24/10S (2|25|36): objs=172 size=275B /24/11N (2|25|36): objs=5812 size=29.06KiB /24/12S (2|25|36): objs=144 size=177B /24/13N (2|25|36): objs=3237 size=13.87KiB /24/14S (2|25|36): objs=159 size=131B /24/16S (2|25|36): objs=144 size=146B /24/17N (2|25|36): objs=646 size=2.54KiB /24/18S (2|25|36): objs=139 size=262B /24/19N (2|25|36): objs=5287 size=24.1KiB /24/20S (2|25|36): objs=172 size=186B /24/21N (2|25|36): objs=577 size=2.09KiB /24/22S (2|25|36): objs=145 size=218B /24/23N (2|25|36): objs=3391 size=14.47KiB /24/24S (2|25|36): objs=147 size=244B /24/25N (2|25|36): objs=1073 size=4.38KiB /24/26S (2|25|36): objs=164 size=315B /24/27N (2|25|36): objs=3540 size=15.66KiB /24/28S (2|25|36): objs=153 size=244B /24/29N (2|25|36): objs=576 size=2.24KiB /24/30S (2|25|36): objs=168 size=111B /24/31N (2|25|36): objs=3612 size=15.79KiB /24/32S (2|25|36): objs=151 size=143B /24/33N (2|25|36): objs=1730 size=7.03KiB /24/34S (2|25|36): objs=150 size=104B /24/35N (2|25|36): objs=1106 size=4.36KiB /25/0N (2|25|36): objs=38643 size=793.59KiB /25/1N (2|25|36): objs=35555 size=613.13KiB /25/2N (2|25|36): objs=37118 size=772.8KiB /25/3N (2|25|36): objs=2124 size=9.32KiB /25/4S (2|25|36): objs=140 size=100B /25/5N (2|25|36): objs=1545 size=6.36KiB /25/6S (2|25|36): objs=149 size=276B /25/7N (2|25|36): objs=1217 size=4.92KiB /25/8S (2|25|36): objs=138 size=286B /25/9N (2|25|36): objs=468 size=1.43KiB /25/10S (2|25|36): objs=152 size=176B /25/11N (2|25|36): objs=1995 size=8.08KiB /25/12S (2|25|36): objs=151 size=154B /25/13N (2|25|36): objs=1813 size=7.36KiB /25/14S (2|25|36): objs=138 size=89B /25/15N (2|25|36): objs=1067 size=4.11KiB /25/16S (2|25|36): objs=150 size=200B /25/17N (2|25|36): objs=1596 size=6.81KiB /25/18S (2|25|36): objs=170 size=342B /25/19N (2|25|36): objs=7568 size=38.32KiB /25/20S (2|25|36): objs=176 size=257B /25/21N (2|25|36): objs=4083 size=17.59KiB /25/22S (2|25|36): objs=170 size=296B /25/23S (2|25|36): objs=141 size=277B /25/24S (2|25|36): objs=135 size=250B /25/25N (2|25|36): objs=641 size=2.38KiB /25/26S (2|25|36): objs=151 size=255B /25/27N (2|25|36): objs=1668 size=6.85KiB /25/28S (2|25|36): objs=154 size=303B /25/29S (2|25|36): objs=165 size=275B /25/30S (2|25|36): objs=142 size=139B /25/31N (2|25|36): objs=4669 size=21.29KiB /25/32S (2|25|36): objs=158 size=91B /25/33N (2|25|36): objs=1816 size=7.51KiB /25/34S (2|25|36): objs=161 size=268B /25/35N (2|25|36): objs=2233 size=9.34KiB /26/0N (2|25|36): objs=38199 size=734.84KiB /26/1N (2|25|36): objs=41481 size=984.67KiB /26/2N (2|25|36): objs=37541 size=809.35KiB /26/3N (2|25|36): objs=1680 size=6.89KiB /26/4S (2|25|36): objs=155 size=86B /26/5N (2|25|36): objs=7007 size=34.05KiB /26/6S (2|25|36): objs=145 size=182B /26/7N (2|25|36): objs=1820 size=7.5KiB /26/8S (2|25|36): objs=169 size=275B /26/9N (2|25|36): objs=2956 size=13.66KiB /26/10S (2|25|36): objs=145 size=284B /26/11N (2|25|36): objs=1593 size=6.73KiB /26/12S (2|25|36): objs=141 size=229B /26/14S (2|25|36): objs=155 size=173B /26/15N (2|25|36): objs=3412 size=14.49KiB /26/16S (2|25|36): objs=135 size=181B /26/17N (2|25|36): objs=1742 size=6.82KiB /26/18S (2|25|36): objs=162 size=120B /26/19N (2|25|36): objs=1083 size=4.3KiB /26/20S (2|25|36): objs=160 size=296B /26/21N (2|25|36): objs=584 size=2.34KiB /26/22S (2|25|36): objs=158 size=278B /26/23N (2|25|36): objs=1526 size=6.21KiB /26/24S (2|25|36): objs=152 size=221B /26/25N (2|25|36): objs=2019 size=8.52KiB /26/26S (2|25|36): objs=162 size=137B /26/27N (2|25|36): objs=2658 size=11.4KiB /26/28S (2|25|36): objs=175 size=197B /26/29N (2|25|36): objs=4241 size=20.71KiB /26/30S (2|25|36): objs=155 size=307B /26/31N (2|25|36): objs=2038 size=8.4KiB /26/32S (2|25|36): objs=186 size=213B /26/33N (2|25|36): objs=1050 size=4.3KiB /26/34S (2|25|36): objs=166 size=83B /26/35N (2|25|36): objs=2432 size=9.98KiB /27/0N (2|25|36): objs=37920 size=739.55KiB /27/1N (2|25|36): objs=36335 size=560.36KiB /27/2N (2|25|36): objs=38405 size=763.23KiB /27/3N (2|25|36): objs=5117 size=23.18KiB /27/4S (2|25|36): objs=162 size=262B /27/5N (2|25|36): objs=9372 size=47.88KiB /27/6S (2|25|36): objs=156 size=186B /27/7N (2|25|36): objs=1631 size=6.8KiB /27/8S (2|25|36): objs=131 size=160B /27/9N (2|25|36): objs=462 size=1.45KiB /27/10S (2|25|36): objs=154 size=165B /27/11N (2|25|36): objs=3157 size=13.36KiB /27/12S (2|25|36): objs=163 size=227B /27/13N (2|25|36): objs=2300 size=10.02KiB /27/14S (2|25|36): objs=149 size=118B /27/15N (2|25|36): objs=1454 size=5.76KiB /27/16S (2|25|36): objs=167 size=96B /27/17N (2|25|36): objs=1641 size=6.84KiB /27/18S (2|25|36): objs=182 size=140B /27/19S (2|25|36): objs=131 size=115B /27/20S (2|25|36): objs=146 size=184B /27/21N (2|25|36): objs=3530 size=14.71KiB /27/22S (2|25|36): objs=182 size=294B /27/24S (2|25|36): objs=157 size=312B /27/25N (2|25|36): objs=397 size=1.44KiB /27/26S (2|25|36): objs=155 size=178B /27/27N (2|25|36): objs=427 size=1.45KiB /27/28S (2|25|36): objs=152 size=156B /27/30S (2|25|36): objs=156 size=226B /27/31N (2|25|36): objs=3352 size=14.15KiB /27/32S (2|25|36): objs=159 size=289B /27/33N (2|25|36): objs=2704 size=11.45KiB /27/34S (2|25|36): objs=141 size=305B /27/35S (2|25|36): objs=143 size=102B /28/0N (2|25|36): objs=34825 size=618.29KiB /28/1N (2|25|36): objs=36717 size=764.6KiB /28/2N (2|25|36): objs=40462 size=791.47KiB /28/3S (2|25|36): objs=161 size=156B /28/4N (2|25|36): objs=3697 size=15.82KiB /28/5N (2|25|36): objs=8423 size=43.23KiB /28/6S (2|25|36): objs=146 size=323B /28/7N (2|25|36): objs=3994 size=17.56KiB /28/8S (2|25|36): objs=136 size=256B /28/9N (2|25|36): objs=3470 size=16.85KiB /28/10S (2|25|36): objs=105 size=136B /28/11N (2|25|36): objs=1501 size=6.06KiB /28/12S (2|25|36): objs=170 size=94B /28/14S (2|25|36): objs=161 size=166B /28/15N (2|25|36): objs=769 size=2.91KiB /28/16S (2|25|36): objs=141 size=154B /28/17N (2|25|36): objs=1040 size=4.14KiB /28/18S (2|25|36): objs=151 size=337B /28/19N (2|25|36): objs=863 size=3.27KiB /28/20S (2|25|36): objs=164 size=284B /28/21N (2|25|36): objs=939 size=3.66KiB /28/22S (2|25|36): objs=149 size=149B /28/23N (2|25|36): objs=2811 size=11.77KiB /28/24S (2|25|36): objs=164 size=217B /28/25N (2|25|36): objs=1321 size=5.39KiB /28/26S (2|25|36): objs=158 size=181B /28/27N (2|25|36): objs=2260 size=9.56KiB /28/28S (2|25|36): objs=163 size=217B /28/29N (2|25|36): objs=318 size=1.07KiB /28/30S (2|25|36): objs=160 size=310B /28/31N (2|25|36): objs=1336 size=5.65KiB /28/32S (2|25|36): objs=156 size=112B /28/33N (2|25|36): objs=4040 size=17.95KiB /28/34S (2|25|36): objs=137 size=214B /28/35N (2|25|36): objs=2887 size=12.26KiB /29/0N (2|25|36): objs=38369 size=733.6KiB /29/1N (2|25|36): objs=39106 size=852.1KiB /29/2N (2|25|36): objs=37772 size=725.45KiB /29/3S (2|25|36): objs=150 size=247B /29/4N (2|25|36): objs=311 size=795B /29/5S (2|25|36): objs=141 size=234B /29/6N (2|25|36): objs=1086 size=4.36KiB /29/7S (2|25|36): objs=153 size=207B /29/8N (2|25|36): objs=1713 size=7.26KiB /29/9N (2|25|36): objs=3773 size=17.96KiB /29/10S (2|25|36): objs=140 size=176B /29/11N (2|25|36): objs=2647 size=12.22KiB /29/12S (2|25|36): objs=144 size=268B /29/13N (2|25|36): objs=994 size=4.02KiB /29/14S (2|25|36): objs=154 size=273B /29/15N (2|25|36): objs=1553 size=6.4KiB /29/16S (2|25|36): objs=134 size=305B /29/17N (2|25|36): objs=2268 size=10.43KiB /29/18S (2|25|36): objs=166 size=281B /29/19N (2|25|36): objs=472 size=1.58KiB /29/20S (2|25|36): objs=152 size=151B /29/21N (2|25|36): objs=9206 size=48.86KiB /29/22S (2|25|36): objs=151 size=230B /29/23N (2|25|36): objs=1076 size=4.25KiB /29/24S (2|25|36): objs=140 size=309B /29/25N (2|25|36): objs=479 size=1.48KiB /29/26S (2|25|36): objs=157 size=278B /29/27N (2|25|36): objs=3008 size=13.02KiB /29/28S (2|25|36): objs=149 size=105B /29/29N (2|25|36): objs=910 size=3.66KiB /29/30S (2|25|36): objs=137 size=143B /29/31N (2|25|36): objs=2375 size=10.28KiB /29/32S (2|25|36): objs=142 size=315B /29/33N (2|25|36): objs=5983 size=27.42KiB /29/34S (2|25|36): objs=162 size=126B /29/35N (2|25|36): objs=1640 size=6.75KiB /30/0N (2|25|36): objs=42800 size=947.67KiB /30/1N (2|25|36): objs=36599 size=637.01KiB /30/2N (2|25|36): objs=26438 size=312.5KiB /30/3S (2|25|36): objs=172 size=284B /30/4N (2|25|36): objs=12338 size=64.63KiB /30/5N (2|25|36): objs=20574 size=156.61KiB /30/6S (2|25|36): objs=145 size=119B /30/7N (2|25|36): objs=769 size=2.85KiB /30/8S (2|25|36): objs=167 size=198B /30/9N (2|25|36): objs=1401 size=5.81KiB /30/10S (2|25|36): objs=154 size=133B /30/11N (2|25|36): objs=613 size=2.11KiB /30/12S (2|25|36): objs=156 size=253B /30/13N (2|25|36): objs=3300 size=14.1KiB /30/14S (2|25|36): objs=145 size=199B /30/15N (2|25|36): objs=654 size=2.2KiB /30/16S (2|25|36): objs=156 size=137B /30/17N (2|25|36): objs=3313 size=15.45KiB /30/18S (2|25|36): objs=153 size=316B /30/19N (2|25|36): objs=455 size=1.59KiB /30/20S (2|25|36): objs=146 size=270B /30/21N (2|25|36): objs=618 size=2.3KiB /30/22S (2|25|36): objs=128 size=119B /30/23N (2|25|36): objs=293 size=979B /30/24S (2|25|36): objs=149 size=286B /30/25N (2|25|36): objs=3108 size=13.46KiB /30/26S (2|25|36): objs=143 size=118B /30/28S (2|25|36): objs=138 size=102B /30/29N (2|25|36): objs=1011 size=4.19KiB /30/30S (2|25|36): objs=172 size=244B /30/31N (2|25|36): objs=1680 size=6.89KiB /30/32S (2|25|36): objs=159 size=316B /30/33N (2|25|36): objs=1100 size=4.43KiB /30/34S (2|25|36): objs=153 size=137B /30/35N (2|25|36): objs=1773 size=7.32KiB /31/0N (2|25|36): objs=37498 size=669.17KiB /31/1N (2|25|36): objs=38812 size=687.97KiB /31/2N (2|25|36): objs=39681 size=829.3KiB /31/3N (2|25|36): objs=4397 size=19.59KiB /31/4S (2|25|36): objs=154 size=226B /31/5N (2|25|36): objs=300 size=826B /31/6S (2|25|36): objs=157 size=164B /31/7N (2|25|36): objs=295 size=773B /31/8S (2|25|36): objs=131 size=147B /31/9N (2|25|36): objs=3153 size=14.39KiB /31/10S (2|25|36): objs=185 size=354B /31/12S (2|25|36): objs=159 size=114B /31/13N (2|25|36): objs=1018 size=3.98KiB /31/14S (2|25|36): objs=162 size=127B /31/15N (2|25|36): objs=433 size=1.57KiB /31/16S (2|25|36): objs=167 size=98B /31/18S (2|25|36): objs=133 size=225B /31/19N (2|25|36): objs=3069 size=13.01KiB /31/20S (2|25|36): objs=147 size=255B /31/21N (2|25|36): objs=1121 size=4.35KiB /31/22S (2|25|36): objs=137 size=298B /31/23N (2|25|36): objs=5918 size=25.12KiB /31/24S (2|25|36): objs=144 size=128B /31/25N (2|25|36): objs=3575 size=14.92KiB /31/26S (2|25|36): objs=163 size=341B /31/27N (2|25|36): objs=3096 size=13.14KiB /31/28S (2|25|36): objs=156 size=281B /31/29N (2|25|36): objs=1470 size=6.14KiB /31/30S (2|25|36): objs=171 size=274B /31/31N (2|25|36): objs=4103 size=17.55KiB /31/32S (2|25|36): objs=138 size=150B /31/33N (2|25|36): objs=1692 size=7.04KiB /31/34S (2|25|36): objs=155 size=222B /31/35N (2|25|36): objs=2128 size=8.81KiB com.milaboratory.util.sorting.HashSorterTest > test2 SKIPPED com.milaboratory.util.sorting.SortingUtilTest > test1 STANDARD_OUT Collation: 390.24ms Sorting: 197.82ms 1 217 41433 99511 99997 Gradle Test Executor 1 finished executing tests. com.milaboratory.util.VersionInfoTest > test3 SKIPPED WARNING: A terminally deprecated method in java.lang.System has been called WARNING: System::setSecurityManager has been called by org.gradle.api.internal.tasks.testing.worker.TestWorker (file:/usr/share/gradle/lib/plugins/gradle-testing-base-4.4.1.jar) WARNING: Please consider reporting this to the maintainers of org.gradle.api.internal.tasks.testing.worker.TestWorker WARNING: System::setSecurityManager will be removed in a future release Finished generating test XML results (0.141 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/test-results/test Generating HTML test report... Finished generating test html results (0.237 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/reports/tests/test :test (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 5 mins 30.152 secs. BUILD SUCCESSFUL in 6m 6s 5 actionable tasks: 3 executed, 2 up-to-date create-stamp debian/debhelper-build-stamp dh_prep dh_auto_install --destdir=debian/libmilib-java/ mh_install jh_installjavadoc dh_installdocs dh_installchangelogs dh_perl dh_link jh_installlibs jh_classpath jh_manifest jh_depends dh_strip_nondeterminism dh_compress dh_fixperms dh_missing dh_installdeb dh_gencontrol dh_md5sums dh_builddeb dpkg-deb: building package 'libmilib-java' in '../libmilib-java_2.2.0+dfsg-1_all.deb'. dpkg-genbuildinfo --build=binary -O../milib_2.2.0+dfsg-1_arm64.buildinfo dpkg-genchanges --build=binary -O../milib_2.2.0+dfsg-1_arm64.changes dpkg-genchanges: info: binary-only upload (no source code included) dpkg-source --after-build . dpkg-buildpackage: info: binary-only upload (no source included) dpkg-genchanges: info: including full source code in upload I: copying local configuration I: user script /srv/workspace/pbuilder/3151131/tmp/hooks/B01_cleanup starting I: user script /srv/workspace/pbuilder/3151131/tmp/hooks/B01_cleanup finished I: unmounting dev/ptmx filesystem I: unmounting dev/pts filesystem I: unmounting dev/shm filesystem I: unmounting proc filesystem I: unmounting sys filesystem I: cleaning the build env I: removing directory /srv/workspace/pbuilder/3151131 and its subdirectories I: Current time: Sat Jun 14 04:29:11 +14 2025 I: pbuilder-time-stamp: 1749824952