I: pbuilder: network access will be disabled during build I: Current time: Sun Apr 28 20:20:44 +14 2024 I: pbuilder-time-stamp: 1714285244 I: Building the build Environment I: extracting base tarball [/var/cache/pbuilder/unstable-reproducible-base.tgz] I: copying local configuration W: --override-config is not set; not updating apt.conf Read the manpage for details. I: mounting /proc filesystem I: mounting /sys filesystem I: creating /{dev,run}/shm I: mounting /dev/pts filesystem I: redirecting /dev/ptmx to /dev/pts/ptmx I: policy-rc.d already exists I: Copying source file I: copying [bioperl-run_1.7.3-11.dsc] I: copying [./bioperl-run_1.7.3.orig.tar.gz] I: copying [./bioperl-run_1.7.3-11.debian.tar.xz] I: Extracting source gpgv: Signature made Sat Apr 27 20:03:48 2024 gpgv: using RSA key 8F91B227C7D6F2B1948C8236793CF67E8F0D11DA gpgv: issuer "emollier@debian.org" gpgv: Can't check signature: No public key dpkg-source: warning: cannot verify inline signature for ./bioperl-run_1.7.3-11.dsc: no acceptable signature found dpkg-source: info: extracting bioperl-run in bioperl-run-1.7.3 dpkg-source: info: unpacking bioperl-run_1.7.3.orig.tar.gz dpkg-source: info: unpacking bioperl-run_1.7.3-11.debian.tar.xz dpkg-source: info: using patch list from debian/patches/series dpkg-source: info: applying Extract_version_from_BEDTools_properly.patch dpkg-source: info: applying skip_tests_for_RemoteBlast_rpsblast.patch dpkg-source: info: applying skip_tests_for_RemoteBlast.patch dpkg-source: info: applying kalign-input-via-piping.patch dpkg-source: info: applying kalign-version-regex.patch dpkg-source: info: applying skip_tests_for_wise.patch dpkg-source: info: applying skip_tests_for_phylip.patch dpkg-source: info: applying skip_tests_for_phyml.patch dpkg-source: info: applying skip_tests_for_infernal.patch dpkg-source: info: applying skip_tests_for_ncbi-blast+.patch dpkg-source: info: applying hyphy.patch dpkg-source: info: applying remove_tests_for_ensembl.patch dpkg-source: info: applying skip_tests_for_soap.patch dpkg-source: info: applying get-overlap.patch dpkg-source: info: applying alternate-data.patch dpkg-source: info: applying skip-test-for-kalign.patch dpkg-source: info: applying fix-whatis-entries.patch dpkg-source: info: applying unscramble-erpin.patch dpkg-source: info: applying fix-pod-conversion.patch dpkg-source: info: applying adjust-muscle-test.patch I: Not using root during the build. I: Installing the build-deps I: user script /srv/workspace/pbuilder/10412/tmp/hooks/D01_modify_environment starting debug: Running on virt64a. I: Changing host+domainname to test build reproducibility I: Adding a custom variable just for the fun of it... I: Changing /bin/sh to bash '/bin/sh' -> '/bin/bash' lrwxrwxrwx 1 root root 9 Apr 28 06:22 /bin/sh -> /bin/bash I: Setting pbuilder2's login shell to /bin/bash I: Setting pbuilder2's GECOS to second user,second room,second work-phone,second home-phone,second other I: user script /srv/workspace/pbuilder/10412/tmp/hooks/D01_modify_environment finished I: user script /srv/workspace/pbuilder/10412/tmp/hooks/D02_print_environment starting I: set BASH=/bin/sh BASHOPTS=checkwinsize:cmdhist:complete_fullquote:extquote:force_fignore:globasciiranges:globskipdots:hostcomplete:interactive_comments:patsub_replacement:progcomp:promptvars:sourcepath BASH_ALIASES=() BASH_ARGC=() BASH_ARGV=() BASH_CMDS=() BASH_LINENO=([0]="12" [1]="0") BASH_LOADABLES_PATH=/usr/local/lib/bash:/usr/lib/bash:/opt/local/lib/bash:/usr/pkg/lib/bash:/opt/pkg/lib/bash:. BASH_SOURCE=([0]="/tmp/hooks/D02_print_environment" [1]="/tmp/hooks/D02_print_environment") BASH_VERSINFO=([0]="5" [1]="2" [2]="21" [3]="1" [4]="release" [5]="arm-unknown-linux-gnueabihf") BASH_VERSION='5.2.21(1)-release' BUILDDIR=/build/reproducible-path BUILDUSERGECOS='second user,second room,second work-phone,second home-phone,second other' BUILDUSERNAME=pbuilder2 BUILD_ARCH=armhf DEBIAN_FRONTEND=noninteractive DEB_BUILD_OPTIONS='buildinfo=+all reproducible=+all parallel=4 ' DIRSTACK=() DISTRIBUTION=unstable EUID=0 FUNCNAME=([0]="Echo" [1]="main") GROUPS=() HOME=/root HOSTNAME=i-capture-the-hostname HOSTTYPE=arm HOST_ARCH=armhf IFS=' ' INVOCATION_ID=cfc77828880949909207583569e40533 LANG=C LANGUAGE=it_CH:it LC_ALL=C MACHTYPE=arm-unknown-linux-gnueabihf MAIL=/var/mail/root OPTERR=1 OPTIND=1 OSTYPE=linux-gnueabihf PATH=/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path PBCURRENTCOMMANDLINEOPERATION=build PBUILDER_OPERATION=build PBUILDER_PKGDATADIR=/usr/share/pbuilder PBUILDER_PKGLIBDIR=/usr/lib/pbuilder PBUILDER_SYSCONFDIR=/etc PIPESTATUS=([0]="0") POSIXLY_CORRECT=y PPID=10412 PS4='+ ' PWD=/ SHELL=/bin/bash SHELLOPTS=braceexpand:errexit:hashall:interactive-comments:posix SHLVL=3 SUDO_COMMAND='/usr/bin/timeout -k 24.1h 24h /usr/bin/ionice -c 3 /usr/bin/nice -n 11 /usr/bin/unshare --uts -- /usr/sbin/pbuilder --build --configfile /srv/reproducible-results/rbuild-debian/r-b-build.f4KhalTm/pbuilderrc_bROz --distribution unstable --hookdir /etc/pbuilder/rebuild-hooks --debbuildopts -b --basetgz /var/cache/pbuilder/unstable-reproducible-base.tgz --buildresult /srv/reproducible-results/rbuild-debian/r-b-build.f4KhalTm/b2 --logfile b2/build.log bioperl-run_1.7.3-11.dsc' SUDO_GID=114 SUDO_UID=108 SUDO_USER=jenkins TERM=unknown TZ=/usr/share/zoneinfo/Etc/GMT-14 UID=0 USER=root _='I: set' http_proxy=http://10.0.0.15:3142/ I: uname -a Linux i-capture-the-hostname 6.1.0-20-arm64 #1 SMP Debian 6.1.85-1 (2024-04-11) aarch64 GNU/Linux I: ls -l /bin lrwxrwxrwx 1 root root 7 Apr 27 07:43 /bin -> usr/bin I: user script /srv/workspace/pbuilder/10412/tmp/hooks/D02_print_environment finished -> Attempting to satisfy build-dependencies -> Creating pbuilder-satisfydepends-dummy package Package: pbuilder-satisfydepends-dummy Version: 0.invalid.0 Architecture: armhf Maintainer: Debian Pbuilder Team Description: Dummy package to satisfy dependencies with aptitude - created by pbuilder This package was created automatically by pbuilder to satisfy the build-dependencies of the package being currently built. Depends: debhelper-compat (= 13), libmodule-build-perl, perl, bioperl (>= 1.7.4), libalgorithm-diff-perl, libipc-run-perl, libio-string-perl, libxml-twig-perl, libfile-sort-perl, libtest-most-perl, libarray-compare-perl, libtree-dagnode-perl, libbio-cluster-perl, libbio-featureio-perl, libconfig-any-perl, libbio-eutilities-perl, libbio-tools-run-remoteblast-perl, amap-align, bedtools-test, ncbi-blast+-legacy, exonerate, hyphy-pt, kalign, mafft, muscle, ncoils, phyml, primer3, probcons, raxml, sim4, wise, fasttree, lagan, pal2nal, libwww-perl dpkg-deb: building package 'pbuilder-satisfydepends-dummy' in '/tmp/satisfydepends-aptitude/pbuilder-satisfydepends-dummy.deb'. Selecting previously unselected package pbuilder-satisfydepends-dummy. (Reading database ... 19443 files and directories currently installed.) Preparing to unpack .../pbuilder-satisfydepends-dummy.deb ... Unpacking pbuilder-satisfydepends-dummy (0.invalid.0) ... dpkg: pbuilder-satisfydepends-dummy: dependency problems, but configuring anyway as you requested: pbuilder-satisfydepends-dummy depends on debhelper-compat (= 13); however: Package debhelper-compat is not installed. pbuilder-satisfydepends-dummy depends on libmodule-build-perl; however: Package libmodule-build-perl is not installed. pbuilder-satisfydepends-dummy depends on bioperl (>= 1.7.4); however: Package bioperl is not installed. pbuilder-satisfydepends-dummy depends on libalgorithm-diff-perl; however: Package libalgorithm-diff-perl is not installed. pbuilder-satisfydepends-dummy depends on libipc-run-perl; however: Package libipc-run-perl is not installed. pbuilder-satisfydepends-dummy depends on libio-string-perl; however: Package libio-string-perl is not installed. pbuilder-satisfydepends-dummy depends on libxml-twig-perl; however: Package libxml-twig-perl is not installed. pbuilder-satisfydepends-dummy depends on libfile-sort-perl; however: Package libfile-sort-perl is not installed. pbuilder-satisfydepends-dummy depends on libtest-most-perl; however: Package libtest-most-perl is not installed. pbuilder-satisfydepends-dummy depends on libarray-compare-perl; however: Package libarray-compare-perl is not installed. pbuilder-satisfydepends-dummy depends on libtree-dagnode-perl; however: Package libtree-dagnode-perl is not installed. pbuilder-satisfydepends-dummy depends on libbio-cluster-perl; however: Package libbio-cluster-perl is not installed. pbuilder-satisfydepends-dummy depends on libbio-featureio-perl; however: Package libbio-featureio-perl is not installed. pbuilder-satisfydepends-dummy depends on libconfig-any-perl; however: Package libconfig-any-perl is not installed. pbuilder-satisfydepends-dummy depends on libbio-eutilities-perl; however: Package libbio-eutilities-perl is not installed. pbuilder-satisfydepends-dummy depends on libbio-tools-run-remoteblast-perl; however: Package libbio-tools-run-remoteblast-perl is not installed. pbuilder-satisfydepends-dummy depends on amap-align; however: Package amap-align is not installed. pbuilder-satisfydepends-dummy depends on bedtools-test; however: Package bedtools-test is not installed. pbuilder-satisfydepends-dummy depends on ncbi-blast+-legacy; however: Package ncbi-blast+-legacy is not installed. pbuilder-satisfydepends-dummy depends on exonerate; however: Package exonerate is not installed. pbuilder-satisfydepends-dummy depends on hyphy-pt; however: Package hyphy-pt is not installed. pbuilder-satisfydepends-dummy depends on kalign; however: Package kalign is not installed. pbuilder-satisfydepends-dummy depends on mafft; however: Package mafft is not installed. pbuilder-satisfydepends-dummy depends on muscle; however: Package muscle is not installed. pbuilder-satisfydepends-dummy depends on ncoils; however: Package ncoils is not installed. pbuilder-satisfydepends-dummy depends on phyml; however: Package phyml is not installed. pbuilder-satisfydepends-dummy depends on primer3; however: Package primer3 is not installed. pbuilder-satisfydepends-dummy depends on probcons; however: Package probcons is not installed. pbuilder-satisfydepends-dummy depends on raxml; however: Package raxml is not installed. pbuilder-satisfydepends-dummy depends on sim4; however: Package sim4 is not installed. pbuilder-satisfydepends-dummy depends on wise; however: Package wise is not installed. pbuilder-satisfydepends-dummy depends on fasttree; however: Package fasttree is not installed. pbuilder-satisfydepends-dummy depends on lagan; however: Package lagan is not installed. pbuilder-satisfydepends-dummy depends on pal2nal; however: Package pal2nal is not installed. pbuilder-satisfydepends-dummy depends on libwww-perl; however: Package libwww-perl is not installed. Setting up pbuilder-satisfydepends-dummy (0.invalid.0) ... Reading package lists... Building dependency tree... Reading state information... Initializing package states... Writing extended state information... Building tag database... pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) The following NEW packages will be installed: amap-align{a} autoconf{a} automake{a} autopoint{a} autotools-dev{a} bedtools-test{a} bioperl{a} bsdextrautils{a} ca-certificates{a} debhelper{a} dh-autoreconf{a} dh-strip-nondeterminism{a} dwz{a} exonerate{a} fasttree{a} file{a} gettext{a} gettext-base{a} groff-base{a} hyphy-common{a} hyphy-pt{a} intltool-debian{a} kalign{a} lagan{a} libalgorithm-diff-perl{a} libarchive-zip-perl{a} libarray-compare-perl{a} libb-hooks-op-check-perl{a} libbio-asn1-entrezgene-perl{a} libbio-cluster-perl{a} libbio-eutilities-perl{a} libbio-featureio-perl{a} libbio-perl-perl{a} libbio-tools-run-remoteblast-perl{a} libbio-variation-perl{a} libbrotli1{a} libbsd0{a} libcapture-tiny-perl{a} libcbor0.10{a} libclass-data-inheritable-perl{a} libclass-method-modifiers-perl{a} libclass-xsaccessor-perl{a} libclone-perl{a} libcom-err2{a} libconfig-any-perl{a} libcurl3t64-gnutls{a} libdata-stag-perl{a} libdebhelper-perl{a} libdevel-callchecker-perl{a} libdevel-stacktrace-perl{a} libdynaloader-functions-perl{a} libedit2{a} libelf1t64{a} libencode-locale-perl{a} libevent-core-2.1-7t64{a} libevent-pthreads-2.1-7t64{a} libexception-class-perl{a} libexpat1{a} libexporter-tiny-perl{a} libfabric1{a} libfido2-1{a} libfile-listing-perl{a} libfile-slurp-tiny-perl{a} libfile-sort-perl{a} libfile-stripnondeterminism-perl{a} libglib2.0-0t64{a} libgssapi-krb5-2{a} libhtml-parser-perl{a} libhtml-tagset-perl{a} libhtml-tree-perl{a} libhttp-cookies-perl{a} libhttp-date-perl{a} libhttp-message-perl{a} libhttp-negotiate-perl{a} libhwloc-plugins{a} libhwloc15{a} libibverbs1{a} libicu72{a} libimport-into-perl{a} libio-html-perl{a} libio-pty-perl{a} libio-socket-ssl-perl{a} libio-string-perl{a} libipc-run-perl{a} libk5crypto3{a} libkeyutils1{a} libkrb5-3{a} libkrb5support0{a} liblmdb0{a} liblwp-mediatypes-perl{a} liblwp-protocol-https-perl{a} libmagic-mgc{a} libmagic1t64{a} libmbedcrypto7t64{a} libmbedtls14t64{a} libmbedx509-1t64{a} libmodule-build-perl{a} libmodule-pluggable-perl{a} libmodule-runtime-perl{a} libmoo-perl{a} libnet-http-perl{a} libnet-ssleay-perl{a} libnghttp2-14{a} libnl-3-200{a} libnl-route-3-200{a} libopenmpi3t64{a} libparams-classify-perl{a} libpciaccess0{a} libpipeline1{a} libpsl5t64{a} libpython3-stdlib{a} libpython3.11-minimal{a} libpython3.11-stdlib{a} librdmacm1t64{a} libreadline8t64{a} librole-tiny-perl{a} librtmp1{a} libssh2-1t64{a} libsub-override-perl{a} libsub-quote-perl{a} libsub-uplevel-perl{a} libtest-deep-perl{a} libtest-differences-perl{a} libtest-exception-perl{a} libtest-most-perl{a} libtest-warn-perl{a} libtext-csv-perl{a} libtext-diff-perl{a} libtimedate-perl{a} libtool{a} libtree-dagnode-perl{a} libtry-tiny-perl{a} libtype-tiny-perl{a} libuchardet0{a} liburi-perl{a} libwww-perl{a} libwww-robotrules-perl{a} libx11-6{a} libx11-data{a} libxau6{a} libxcb1{a} libxdmcp6{a} libxext6{a} libxml-dom-perl{a} libxml-dom-xpath-perl{a} libxml-libxml-perl{a} libxml-namespacesupport-perl{a} libxml-parser-perl{a} libxml-perl{a} libxml-regexp-perl{a} libxml-sax-base-perl{a} libxml-sax-perl{a} libxml-simple-perl{a} libxml-twig-perl{a} libxml-writer-perl{a} libxml-xpathengine-perl{a} libxml2{a} libxnvctrl0{a} m4{a} mafft{a} man-db{a} media-types{a} muscle{a} ncbi-blast+{a} ncbi-blast+-legacy{a} ncbi-data{a} ncoils{a} netbase{a} ocl-icd-libopencl1{a} openmpi-bin{a} openmpi-common{a} openssh-client{a} openssl{a} pal2nal{a} perl-openssl-defaults{a} phyml{a} po-debconf{a} primer3{a} probcons{a} python3{a} python3-minimal{a} python3.11{a} python3.11-minimal{a} raxml{a} readline-common{a} sensible-utils{a} sim4{a} tzdata{a} ucf{a} wise{a} wise-data{a} The following packages are RECOMMENDED but will NOT be installed: bioperl-run curl ibverbs-providers krb5-locales libace-perl libalgorithm-diff-xs-perl libalgorithm-munkres-perl libapache-dbi-perl libarchive-cpio-perl libbio-perl-run-perl libcache-cache-perl libconfig-general-perl libconfig-tiny-perl libconvert-binary-c-perl libdata-dump-perl libdbd-mysql-perl libdbd-pg-perl libdbd-sqlite3-perl libdbi-perl libgd-perl libglib2.0-data libgraph-perl libgraphviz-perl libhtml-form-perl libhtml-format-perl libhtml-tableextract-perl libhttp-daemon-perl libio-compress-brotli-perl liblist-moreutils-perl libltdl-dev libmail-sendmail-perl libmailtools-perl libmldbm-perl libmodule-signature-perl libnamespace-clean-perl libpod-readme-perl libpostscript-perl libref-util-perl libset-scalar-perl libsoap-lite-perl libsoftware-license-perl libsort-naturally-perl libspreadsheet-parseexcel-perl libspreadsheet-writeexcel-perl libsvg-graph-perl libsvg-perl libtext-csv-xs-perl libtext-iconv-perl libtie-ixhash-perl libtype-tiny-xs-perl libxml-libxslt-perl libxml-sax-expat-perl libxml-sax-writer-perl libxstring-perl libyaml-libyaml-perl libyaml-perl libyaml-syck-perl lynx paml perl-doc perl-tk publicsuffix ruby shared-mime-info wget xauth xdg-user-dirs 0 packages upgraded, 191 newly installed, 0 to remove and 0 not upgraded. Need to get 76.1 MB of archives. After unpacking 291 MB will be used. Writing extended state information... Get: 1 http://deb.debian.org/debian unstable/main armhf libpython3.11-minimal armhf 3.11.9-1 [805 kB] Get: 2 http://deb.debian.org/debian unstable/main armhf libexpat1 armhf 2.6.2-1 [83.5 kB] Get: 3 http://deb.debian.org/debian unstable/main armhf python3.11-minimal armhf 3.11.9-1 [1600 kB] Get: 4 http://deb.debian.org/debian unstable/main armhf python3-minimal armhf 3.11.8-1 [26.3 kB] Get: 5 http://deb.debian.org/debian unstable/main armhf media-types all 10.1.0 [26.9 kB] Get: 6 http://deb.debian.org/debian unstable/main armhf netbase all 6.4 [12.8 kB] Get: 7 http://deb.debian.org/debian unstable/main armhf tzdata all 2024a-3 [255 kB] Get: 8 http://deb.debian.org/debian unstable/main armhf readline-common all 8.2-4 [69.3 kB] Get: 9 http://deb.debian.org/debian unstable/main armhf libreadline8t64 armhf 8.2-4 [145 kB] Get: 10 http://deb.debian.org/debian unstable/main armhf libpython3.11-stdlib armhf 3.11.9-1 [1704 kB] Get: 11 http://deb.debian.org/debian unstable/main armhf python3.11 armhf 3.11.9-1 [602 kB] Get: 12 http://deb.debian.org/debian unstable/main armhf libpython3-stdlib armhf 3.11.8-1 [9332 B] Get: 13 http://deb.debian.org/debian unstable/main armhf python3 armhf 3.11.8-1 [27.4 kB] Get: 14 http://deb.debian.org/debian unstable/main armhf sensible-utils all 0.0.22 [22.4 kB] Get: 15 http://deb.debian.org/debian unstable/main armhf openssl armhf 3.2.1-3 [1326 kB] Get: 16 http://deb.debian.org/debian unstable/main armhf ca-certificates all 20240203 [158 kB] Get: 17 http://deb.debian.org/debian unstable/main armhf libmagic-mgc armhf 1:5.45-3 [314 kB] Get: 18 http://deb.debian.org/debian unstable/main armhf libmagic1t64 armhf 1:5.45-3 [98.1 kB] Get: 19 http://deb.debian.org/debian unstable/main armhf file armhf 1:5.45-3 [42.0 kB] Get: 20 http://deb.debian.org/debian unstable/main armhf gettext-base armhf 0.21-14+b1 [157 kB] Get: 21 http://deb.debian.org/debian unstable/main armhf libuchardet0 armhf 0.0.8-1+b1 [65.7 kB] Get: 22 http://deb.debian.org/debian unstable/main armhf groff-base armhf 1.23.0-3+b1 [1091 kB] Get: 23 http://deb.debian.org/debian unstable/main armhf bsdextrautils armhf 2.40-8 [85.6 kB] Get: 24 http://deb.debian.org/debian unstable/main armhf libpipeline1 armhf 1.5.7-2 [33.3 kB] Get: 25 http://deb.debian.org/debian unstable/main armhf man-db armhf 2.12.1-1 [1375 kB] Get: 26 http://deb.debian.org/debian unstable/main armhf libbsd0 armhf 0.12.2-1 [127 kB] Get: 27 http://deb.debian.org/debian unstable/main armhf libedit2 armhf 3.1-20230828-1+b1 [77.6 kB] Get: 28 http://deb.debian.org/debian unstable/main armhf libcbor0.10 armhf 0.10.2-1.2 [24.3 kB] Get: 29 http://deb.debian.org/debian unstable/main armhf libfido2-1 armhf 1.14.0-1+b2 [70.4 kB] Get: 30 http://deb.debian.org/debian unstable/main armhf libkrb5support0 armhf 1.20.1-6+b1 [30.6 kB] Get: 31 http://deb.debian.org/debian unstable/main armhf libcom-err2 armhf 1.47.0-2.4 [19.5 kB] Get: 32 http://deb.debian.org/debian unstable/main armhf libk5crypto3 armhf 1.20.1-6+b1 [75.5 kB] Get: 33 http://deb.debian.org/debian unstable/main armhf libkeyutils1 armhf 1.6.3-3 [7908 B] Get: 34 http://deb.debian.org/debian unstable/main armhf libkrb5-3 armhf 1.20.1-6+b1 [290 kB] Get: 35 http://deb.debian.org/debian unstable/main armhf libgssapi-krb5-2 armhf 1.20.1-6+b1 [112 kB] Get: 36 http://deb.debian.org/debian unstable/main armhf openssh-client armhf 1:9.7p1-4 [870 kB] Get: 37 http://deb.debian.org/debian unstable/main armhf ucf all 3.0043+nmu1 [55.2 kB] Get: 38 http://deb.debian.org/debian unstable/main armhf amap-align armhf 2.2+git20080214.600fc29+dfsg-2 [110 kB] Get: 39 http://deb.debian.org/debian unstable/main armhf m4 armhf 1.4.19-4 [264 kB] Get: 40 http://deb.debian.org/debian unstable/main armhf autoconf all 2.71-3 [332 kB] Get: 41 http://deb.debian.org/debian unstable/main armhf autotools-dev all 20220109.1 [51.6 kB] Get: 42 http://deb.debian.org/debian unstable/main armhf automake all 1:1.16.5-1.3 [823 kB] Get: 43 http://deb.debian.org/debian unstable/main armhf autopoint all 0.21-14 [496 kB] Get: 44 http://deb.debian.org/debian unstable/main armhf bedtools-test all 2.31.1+dfsg-2 [10.9 MB] Get: 45 http://deb.debian.org/debian unstable/main armhf libio-string-perl all 1.08-4 [12.1 kB] Get: 46 http://deb.debian.org/debian unstable/main armhf libdata-stag-perl all 0.14-3 [448 kB] Get: 47 http://deb.debian.org/debian unstable/main armhf libbio-perl-perl all 1.7.8-1 [2603 kB] Get: 48 http://deb.debian.org/debian unstable/main armhf libclass-data-inheritable-perl all 0.08-3 [8588 B] Get: 49 http://deb.debian.org/debian unstable/main armhf libdevel-stacktrace-perl all 2.0500-1 [26.4 kB] Get: 50 http://deb.debian.org/debian unstable/main armhf libexception-class-perl all 1.45-1 [34.6 kB] Get: 51 http://deb.debian.org/debian unstable/main armhf libtest-deep-perl all 1.204-1 [52.9 kB] Get: 52 http://deb.debian.org/debian unstable/main armhf libcapture-tiny-perl all 0.48-2 [24.6 kB] Get: 53 http://deb.debian.org/debian unstable/main armhf libalgorithm-diff-perl all 1.201-1 [43.3 kB] Get: 54 http://deb.debian.org/debian unstable/main armhf libtext-diff-perl all 1.45-2 [27.2 kB] Get: 55 http://deb.debian.org/debian unstable/main armhf libtest-differences-perl all 0.71-1 [17.9 kB] Get: 56 http://deb.debian.org/debian unstable/main armhf libsub-uplevel-perl all 0.2800-3 [14.0 kB] Get: 57 http://deb.debian.org/debian unstable/main armhf libtest-exception-perl all 0.43-3 [16.9 kB] Get: 58 http://deb.debian.org/debian unstable/main armhf libtest-warn-perl all 0.37-2 [14.5 kB] Get: 59 http://deb.debian.org/debian unstable/main armhf libtest-most-perl all 0.38-1 [25.1 kB] Get: 60 http://deb.debian.org/debian unstable/main armhf bioperl all 1.7.8-1 [246 kB] Get: 61 http://deb.debian.org/debian unstable/main armhf libdebhelper-perl all 13.15.3 [88.0 kB] Get: 62 http://deb.debian.org/debian unstable/main armhf libtool all 2.4.7-7 [517 kB] Get: 63 http://deb.debian.org/debian unstable/main armhf dh-autoreconf all 20 [17.1 kB] Get: 64 http://deb.debian.org/debian unstable/main armhf libarchive-zip-perl all 1.68-1 [104 kB] Get: 65 http://deb.debian.org/debian unstable/main armhf libsub-override-perl all 0.10-1 [10.6 kB] Get: 66 http://deb.debian.org/debian unstable/main armhf libfile-stripnondeterminism-perl all 1.13.1-1 [19.4 kB] Get: 67 http://deb.debian.org/debian unstable/main armhf dh-strip-nondeterminism all 1.13.1-1 [8620 B] Get: 68 http://deb.debian.org/debian unstable/main armhf libelf1t64 armhf 0.191-1+b1 [183 kB] Get: 69 http://deb.debian.org/debian unstable/main armhf dwz armhf 0.15-1+b2 [106 kB] Get: 70 http://deb.debian.org/debian unstable/main armhf libicu72 armhf 72.1-4+b1 [9070 kB] Get: 71 http://deb.debian.org/debian unstable/main armhf libxml2 armhf 2.9.14+dfsg-1.3+b3 [598 kB] Get: 72 http://deb.debian.org/debian unstable/main armhf gettext armhf 0.21-14+b1 [1230 kB] Get: 73 http://deb.debian.org/debian unstable/main armhf intltool-debian all 0.35.0+20060710.6 [22.9 kB] Get: 74 http://deb.debian.org/debian unstable/main armhf po-debconf all 1.0.21+nmu1 [248 kB] Get: 75 http://deb.debian.org/debian unstable/main armhf debhelper all 13.15.3 [901 kB] Get: 76 http://deb.debian.org/debian unstable/main armhf libglib2.0-0t64 armhf 2.78.4-7 [1285 kB] Get: 77 http://deb.debian.org/debian unstable/main armhf exonerate armhf 2.4.0-5+b1 [1661 kB] Get: 78 http://deb.debian.org/debian unstable/main armhf fasttree armhf 2.1.11-2 [169 kB] Get: 79 http://deb.debian.org/debian unstable/main armhf hyphy-common all 2.5.60+dfsg-1 [604 kB] Get: 80 http://deb.debian.org/debian unstable/main armhf libbrotli1 armhf 1.1.0-2+b3 [284 kB] Get: 81 http://deb.debian.org/debian unstable/main armhf libnghttp2-14 armhf 1.61.0-1+b1 [64.1 kB] Get: 82 http://deb.debian.org/debian unstable/main armhf libpsl5t64 armhf 0.21.2-1.1 [55.6 kB] Get: 83 http://deb.debian.org/debian unstable/main armhf librtmp1 armhf 2.4+20151223.gitfa8646d.1-2+b4 [53.2 kB] Get: 84 http://deb.debian.org/debian unstable/main armhf libssh2-1t64 armhf 1.11.0-4.1+b2 [198 kB] Get: 85 http://deb.debian.org/debian unstable/main armhf libcurl3t64-gnutls armhf 8.7.1-3 [384 kB] Get: 86 http://deb.debian.org/debian unstable/main armhf hyphy-pt armhf 2.5.60+dfsg-1 [762 kB] Get: 87 http://deb.debian.org/debian unstable/main armhf kalign armhf 1:3.4.0-1 [78.7 kB] Get: 88 http://deb.debian.org/debian unstable/main armhf lagan armhf 2.0-10 [166 kB] Get: 89 http://deb.debian.org/debian unstable/main armhf libclass-method-modifiers-perl all 2.15-1 [18.0 kB] Get: 90 http://deb.debian.org/debian unstable/main armhf libclass-xsaccessor-perl armhf 1.19-4+b3 [35.4 kB] Get: 91 http://deb.debian.org/debian unstable/main armhf libb-hooks-op-check-perl armhf 0.22-3+b1 [10.2 kB] Get: 92 http://deb.debian.org/debian unstable/main armhf libdynaloader-functions-perl all 0.003-3 [12.7 kB] Get: 93 http://deb.debian.org/debian unstable/main armhf libdevel-callchecker-perl armhf 0.008-2+b2 [14.9 kB] Get: 94 http://deb.debian.org/debian unstable/main armhf libparams-classify-perl armhf 0.015-2+b3 [21.3 kB] Get: 95 http://deb.debian.org/debian unstable/main armhf libmodule-runtime-perl all 0.016-2 [19.6 kB] Get: 96 http://deb.debian.org/debian unstable/main armhf libimport-into-perl all 1.002005-2 [11.3 kB] Get: 97 http://deb.debian.org/debian unstable/main armhf librole-tiny-perl all 2.002004-1 [21.4 kB] Get: 98 http://deb.debian.org/debian unstable/main armhf libsub-quote-perl all 2.006008-1 [21.8 kB] Get: 99 http://deb.debian.org/debian unstable/main armhf libmoo-perl all 2.005005-1 [58.0 kB] Get: 100 http://deb.debian.org/debian unstable/main armhf libexporter-tiny-perl all 1.006002-1 [38.7 kB] Get: 101 http://deb.debian.org/debian unstable/main armhf libtype-tiny-perl all 2.004000-1 [357 kB] Get: 102 http://deb.debian.org/debian unstable/main armhf libarray-compare-perl all 3.0.8-1 [14.9 kB] Get: 103 http://deb.debian.org/debian unstable/main armhf liburi-perl all 5.28-1 [98.6 kB] Get: 104 http://deb.debian.org/debian unstable/main armhf libencode-locale-perl all 1.05-3 [12.9 kB] Get: 105 http://deb.debian.org/debian unstable/main armhf libtimedate-perl all 2.3300-2 [39.3 kB] Get: 106 http://deb.debian.org/debian unstable/main armhf libhttp-date-perl all 6.06-1 [10.7 kB] Get: 107 http://deb.debian.org/debian unstable/main armhf libfile-listing-perl all 6.16-1 [12.4 kB] Get: 108 http://deb.debian.org/debian unstable/main armhf libhtml-tagset-perl all 3.24-1 [14.7 kB] Get: 109 http://deb.debian.org/debian unstable/main armhf libhtml-parser-perl armhf 3.82-1 [95.6 kB] Get: 110 http://deb.debian.org/debian unstable/main armhf libhtml-tree-perl all 5.07-3 [211 kB] Get: 111 http://deb.debian.org/debian unstable/main armhf libclone-perl armhf 0.46-1+b2 [13.1 kB] Get: 112 http://deb.debian.org/debian unstable/main armhf libio-html-perl all 1.004-3 [16.2 kB] Get: 113 http://deb.debian.org/debian unstable/main armhf liblwp-mediatypes-perl all 6.04-2 [20.2 kB] Get: 114 http://deb.debian.org/debian unstable/main armhf libhttp-message-perl all 6.45-1 [82.0 kB] Get: 115 http://deb.debian.org/debian unstable/main armhf libhttp-cookies-perl all 6.11-1 [19.1 kB] Get: 116 http://deb.debian.org/debian unstable/main armhf libhttp-negotiate-perl all 6.01-2 [13.1 kB] Get: 117 http://deb.debian.org/debian unstable/main armhf perl-openssl-defaults armhf 7+b2 [6708 B] Get: 118 http://deb.debian.org/debian unstable/main armhf libnet-ssleay-perl armhf 1.94-1+b1 [319 kB] Get: 119 http://deb.debian.org/debian unstable/main armhf libio-socket-ssl-perl all 2.085-1 [218 kB] Get: 120 http://deb.debian.org/debian unstable/main armhf libnet-http-perl all 6.23-1 [23.9 kB] Get: 121 http://deb.debian.org/debian unstable/main armhf liblwp-protocol-https-perl all 6.14-1 [10.8 kB] Get: 122 http://deb.debian.org/debian unstable/main armhf libtry-tiny-perl all 0.31-2 [22.6 kB] Get: 123 http://deb.debian.org/debian unstable/main armhf libwww-robotrules-perl all 6.02-1 [12.9 kB] Get: 124 http://deb.debian.org/debian unstable/main armhf libwww-perl all 6.77-1 [183 kB] Get: 125 http://deb.debian.org/debian unstable/main armhf libxml-parser-perl armhf 2.47-1+b2 [196 kB] Get: 126 http://deb.debian.org/debian unstable/main armhf libxml-twig-perl all 1:3.52-3 [177 kB] Get: 127 http://deb.debian.org/debian unstable/main armhf libxml-writer-perl all 0.900-2 [26.8 kB] Get: 128 http://deb.debian.org/debian unstable/main armhf libbio-variation-perl all 1.7.5-3 [72.6 kB] Get: 129 http://deb.debian.org/debian unstable/main armhf libxml-namespacesupport-perl all 1.12-2 [15.1 kB] Get: 130 http://deb.debian.org/debian unstable/main armhf libxml-sax-base-perl all 1.09-3 [20.6 kB] Get: 131 http://deb.debian.org/debian unstable/main armhf libxml-sax-perl all 1.02+dfsg-3 [59.4 kB] Get: 132 http://deb.debian.org/debian unstable/main armhf libbio-cluster-perl all 1.7.3-6 [53.3 kB] Get: 133 http://deb.debian.org/debian unstable/main armhf libbio-asn1-entrezgene-perl all 1.730-3 [46.3 kB] Get: 134 http://deb.debian.org/debian unstable/main armhf libtext-csv-perl all 2.04-1 [112 kB] Get: 135 http://deb.debian.org/debian unstable/main armhf libxml-libxml-perl armhf 2.0207+dfsg+really+2.0134-1+b4 [297 kB] Get: 136 http://deb.debian.org/debian unstable/main armhf libxml-simple-perl all 2.25-2 [69.8 kB] Get: 137 http://deb.debian.org/debian unstable/main armhf libbio-eutilities-perl all 1.77-2 [124 kB] Get: 138 http://deb.debian.org/debian unstable/main armhf libfile-slurp-tiny-perl all 0.004-2 [7592 B] Get: 139 http://deb.debian.org/debian unstable/main armhf libtree-dagnode-perl all 1.32-1 [61.7 kB] Get: 140 http://deb.debian.org/debian unstable/main armhf libxml-perl all 0.08-4 [93.0 kB] Get: 141 http://deb.debian.org/debian unstable/main armhf libxml-regexp-perl all 0.04-1.1 [7500 B] Get: 142 http://deb.debian.org/debian unstable/main armhf libxml-dom-perl all 1.46-2 [152 kB] Get: 143 http://deb.debian.org/debian unstable/main armhf libxml-xpathengine-perl all 0.14-2 [33.5 kB] Get: 144 http://deb.debian.org/debian unstable/main armhf libxml-dom-xpath-perl all 0.14-4 [9352 B] Get: 145 http://deb.debian.org/debian unstable/main armhf libbio-featureio-perl all 1.6.905-2 [53.2 kB] Get: 146 http://deb.debian.org/debian unstable/main armhf libbio-tools-run-remoteblast-perl all 1.7.3-3 [17.5 kB] Get: 147 http://deb.debian.org/debian unstable/main armhf libmodule-pluggable-perl all 5.2-5 [23.0 kB] Get: 148 http://deb.debian.org/debian unstable/main armhf libconfig-any-perl all 0.33-1 [31.0 kB] Get: 149 http://deb.debian.org/debian unstable/main armhf libevent-core-2.1-7t64 armhf 2.1.12-stable-8.1+b3 [122 kB] Get: 150 http://deb.debian.org/debian unstable/main armhf libevent-pthreads-2.1-7t64 armhf 2.1.12-stable-8.1+b3 [53.8 kB] Get: 151 http://deb.debian.org/debian unstable/main armhf libnl-3-200 armhf 3.7.0-0.3 [51.7 kB] Get: 152 http://deb.debian.org/debian unstable/main armhf libnl-route-3-200 armhf 3.7.0-0.3 [153 kB] Get: 153 http://deb.debian.org/debian unstable/main armhf libibverbs1 armhf 50.0-2+b1 [55.0 kB] Get: 154 http://deb.debian.org/debian unstable/main armhf librdmacm1t64 armhf 50.0-2+b1 [62.1 kB] Get: 155 http://deb.debian.org/debian unstable/main armhf libfabric1 armhf 1.17.0-3+b1 [386 kB] Get: 156 http://deb.debian.org/debian unstable/main armhf libfile-sort-perl all 1.01-3 [21.3 kB] Get: 157 http://deb.debian.org/debian unstable/main armhf libpciaccess0 armhf 0.17-3+b1 [49.3 kB] Get: 158 http://deb.debian.org/debian unstable/main armhf libxau6 armhf 1:1.0.9-1+b1 [17.4 kB] Get: 159 http://deb.debian.org/debian unstable/main armhf libxdmcp6 armhf 1:1.1.2-3+b1 [23.0 kB] Get: 160 http://deb.debian.org/debian unstable/main armhf libxcb1 armhf 1.17.0-1 [140 kB] Get: 161 http://deb.debian.org/debian unstable/main armhf libx11-data all 2:1.8.7-1 [328 kB] Get: 162 http://deb.debian.org/debian unstable/main armhf libx11-6 armhf 2:1.8.7-1 [735 kB] Get: 163 http://deb.debian.org/debian unstable/main armhf libxext6 armhf 2:1.3.4-1+b1 [47.8 kB] Get: 164 http://deb.debian.org/debian unstable/main armhf libxnvctrl0 armhf 535.171.04-1 [12.8 kB] Get: 165 http://deb.debian.org/debian unstable/main armhf ocl-icd-libopencl1 armhf 2.3.2-1+b1 [37.3 kB] Get: 166 http://deb.debian.org/debian unstable/main armhf libhwloc15 armhf 2.10.0-1+b1 [133 kB] Get: 167 http://deb.debian.org/debian unstable/main armhf libhwloc-plugins armhf 2.10.0-1+b1 [16.1 kB] Get: 168 http://deb.debian.org/debian unstable/main armhf libio-pty-perl armhf 1:1.20-1+b1 [33.9 kB] Get: 169 http://deb.debian.org/debian unstable/main armhf libipc-run-perl all 20231003.0-2 [101 kB] Get: 170 http://deb.debian.org/debian unstable/main armhf liblmdb0 armhf 0.9.31-1+b1 [37.6 kB] Get: 171 http://deb.debian.org/debian unstable/main armhf libmbedcrypto7t64 armhf 2.28.8-1 [251 kB] Get: 172 http://deb.debian.org/debian unstable/main armhf libmbedx509-1t64 armhf 2.28.8-1 [127 kB] Get: 173 http://deb.debian.org/debian unstable/main armhf libmbedtls14t64 armhf 2.28.8-1 [158 kB] Get: 174 http://deb.debian.org/debian unstable/main armhf libmodule-build-perl all 0.423400-2 [252 kB] Get: 175 http://deb.debian.org/debian unstable/main armhf libopenmpi3t64 armhf 4.1.6-13 [2090 kB] Get: 176 http://deb.debian.org/debian unstable/main armhf mafft armhf 7.505-1 [784 kB] Get: 177 http://deb.debian.org/debian unstable/main armhf muscle armhf 1:5.1.0-1 [248 kB] Get: 178 http://deb.debian.org/debian unstable/main armhf ncbi-data all 6.1.20170106+dfsg2-2 [3544 kB] Get: 179 http://deb.debian.org/debian unstable/main armhf ncbi-blast+ armhf 2.12.0+ds-4+b1 [10.9 MB] Get: 180 http://deb.debian.org/debian unstable/main armhf ncbi-blast+-legacy all 2.12.0+ds-4 [8956 B] Get: 181 http://deb.debian.org/debian unstable/main armhf ncoils armhf 2002-9 [21.4 kB] Get: 182 http://deb.debian.org/debian unstable/main armhf openmpi-common all 4.1.6-13 [169 kB] Get: 183 http://deb.debian.org/debian unstable/main armhf openmpi-bin armhf 4.1.6-13 [195 kB] Get: 184 http://deb.debian.org/debian unstable/main armhf pal2nal all 14.1-3 [17.8 kB] Get: 185 http://deb.debian.org/debian unstable/main armhf phyml armhf 3:3.3.20220408-3+b1 [987 kB] Get: 186 http://deb.debian.org/debian unstable/main armhf primer3 armhf 2.6.1-4 [182 kB] Get: 187 http://deb.debian.org/debian unstable/main armhf probcons armhf 1.12-14 [106 kB] Get: 188 http://deb.debian.org/debian unstable/main armhf raxml armhf 8.2.13+dfsg-1 [963 kB] Get: 189 http://deb.debian.org/debian unstable/main armhf sim4 armhf 0.0.20121010-8 [353 kB] Get: 190 http://deb.debian.org/debian unstable/main armhf wise-data all 2.4.1-24 [76.0 kB] Get: 191 http://deb.debian.org/debian unstable/main armhf wise armhf 2.4.1-24 [785 kB] Fetched 76.1 MB in 3s (25.7 MB/s) debconf: delaying package configuration, since apt-utils is not installed Selecting previously unselected package libpython3.11-minimal:armhf. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19443 files and directories currently installed.) Preparing to unpack .../libpython3.11-minimal_3.11.9-1_armhf.deb ... Unpacking libpython3.11-minimal:armhf (3.11.9-1) ... Selecting previously unselected package libexpat1:armhf. Preparing to unpack .../libexpat1_2.6.2-1_armhf.deb ... Unpacking libexpat1:armhf (2.6.2-1) ... Selecting previously unselected package python3.11-minimal. Preparing to unpack .../python3.11-minimal_3.11.9-1_armhf.deb ... Unpacking python3.11-minimal (3.11.9-1) ... Setting up libpython3.11-minimal:armhf (3.11.9-1) ... Setting up libexpat1:armhf (2.6.2-1) ... Setting up python3.11-minimal (3.11.9-1) ... Selecting previously unselected package python3-minimal. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19759 files and directories currently installed.) Preparing to unpack .../0-python3-minimal_3.11.8-1_armhf.deb ... Unpacking python3-minimal (3.11.8-1) ... Selecting previously unselected package media-types. Preparing to unpack .../1-media-types_10.1.0_all.deb ... Unpacking media-types (10.1.0) ... Selecting previously unselected package netbase. Preparing to unpack .../2-netbase_6.4_all.deb ... Unpacking netbase (6.4) ... Selecting previously unselected package tzdata. Preparing to unpack .../3-tzdata_2024a-3_all.deb ... Unpacking tzdata (2024a-3) ... Selecting previously unselected package readline-common. Preparing to unpack .../4-readline-common_8.2-4_all.deb ... Unpacking readline-common (8.2-4) ... Selecting previously unselected package libreadline8t64:armhf. Preparing to unpack .../5-libreadline8t64_8.2-4_armhf.deb ... Adding 'diversion of /lib/arm-linux-gnueabihf/libhistory.so.8 to /lib/arm-linux-gnueabihf/libhistory.so.8.usr-is-merged by libreadline8t64' Adding 'diversion of /lib/arm-linux-gnueabihf/libhistory.so.8.2 to /lib/arm-linux-gnueabihf/libhistory.so.8.2.usr-is-merged by libreadline8t64' Adding 'diversion of /lib/arm-linux-gnueabihf/libreadline.so.8 to /lib/arm-linux-gnueabihf/libreadline.so.8.usr-is-merged by libreadline8t64' Adding 'diversion of /lib/arm-linux-gnueabihf/libreadline.so.8.2 to /lib/arm-linux-gnueabihf/libreadline.so.8.2.usr-is-merged by libreadline8t64' Unpacking libreadline8t64:armhf (8.2-4) ... Selecting previously unselected package libpython3.11-stdlib:armhf. Preparing to unpack .../6-libpython3.11-stdlib_3.11.9-1_armhf.deb ... Unpacking libpython3.11-stdlib:armhf (3.11.9-1) ... Selecting previously unselected package python3.11. Preparing to unpack .../7-python3.11_3.11.9-1_armhf.deb ... Unpacking python3.11 (3.11.9-1) ... Selecting previously unselected package libpython3-stdlib:armhf. Preparing to unpack .../8-libpython3-stdlib_3.11.8-1_armhf.deb ... Unpacking libpython3-stdlib:armhf (3.11.8-1) ... Setting up python3-minimal (3.11.8-1) ... Selecting previously unselected package python3. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 20751 files and directories currently installed.) Preparing to unpack .../000-python3_3.11.8-1_armhf.deb ... Unpacking python3 (3.11.8-1) ... Selecting previously unselected package sensible-utils. Preparing to unpack .../001-sensible-utils_0.0.22_all.deb ... Unpacking sensible-utils (0.0.22) ... Selecting previously unselected package openssl. Preparing to unpack .../002-openssl_3.2.1-3_armhf.deb ... Unpacking openssl (3.2.1-3) ... Selecting previously unselected package ca-certificates. Preparing to unpack .../003-ca-certificates_20240203_all.deb ... Unpacking ca-certificates (20240203) ... Selecting previously unselected package libmagic-mgc. Preparing to unpack .../004-libmagic-mgc_1%3a5.45-3_armhf.deb ... Unpacking libmagic-mgc (1:5.45-3) ... Selecting previously unselected package libmagic1t64:armhf. Preparing to unpack .../005-libmagic1t64_1%3a5.45-3_armhf.deb ... Unpacking libmagic1t64:armhf (1:5.45-3) ... Selecting previously unselected package file. Preparing to unpack .../006-file_1%3a5.45-3_armhf.deb ... Unpacking file (1:5.45-3) ... Selecting previously unselected package gettext-base. Preparing to unpack .../007-gettext-base_0.21-14+b1_armhf.deb ... Unpacking gettext-base (0.21-14+b1) ... Selecting previously unselected package libuchardet0:armhf. Preparing to unpack .../008-libuchardet0_0.0.8-1+b1_armhf.deb ... Unpacking libuchardet0:armhf (0.0.8-1+b1) ... Selecting previously unselected package groff-base. Preparing to unpack .../009-groff-base_1.23.0-3+b1_armhf.deb ... Unpacking groff-base (1.23.0-3+b1) ... Selecting previously unselected package bsdextrautils. Preparing to unpack .../010-bsdextrautils_2.40-8_armhf.deb ... Unpacking bsdextrautils (2.40-8) ... Selecting previously unselected package libpipeline1:armhf. Preparing to unpack .../011-libpipeline1_1.5.7-2_armhf.deb ... Unpacking libpipeline1:armhf (1.5.7-2) ... Selecting previously unselected package man-db. Preparing to unpack .../012-man-db_2.12.1-1_armhf.deb ... Unpacking man-db (2.12.1-1) ... Selecting previously unselected package libbsd0:armhf. Preparing to unpack .../013-libbsd0_0.12.2-1_armhf.deb ... Unpacking libbsd0:armhf (0.12.2-1) ... Selecting previously unselected package libedit2:armhf. Preparing to unpack .../014-libedit2_3.1-20230828-1+b1_armhf.deb ... Unpacking libedit2:armhf (3.1-20230828-1+b1) ... Selecting previously unselected package libcbor0.10:armhf. Preparing to unpack .../015-libcbor0.10_0.10.2-1.2_armhf.deb ... Unpacking libcbor0.10:armhf (0.10.2-1.2) ... Selecting previously unselected package libfido2-1:armhf. Preparing to unpack .../016-libfido2-1_1.14.0-1+b2_armhf.deb ... Unpacking libfido2-1:armhf (1.14.0-1+b2) ... Selecting previously unselected package libkrb5support0:armhf. Preparing to unpack .../017-libkrb5support0_1.20.1-6+b1_armhf.deb ... Unpacking libkrb5support0:armhf (1.20.1-6+b1) ... Selecting previously unselected package libcom-err2:armhf. Preparing to unpack .../018-libcom-err2_1.47.0-2.4_armhf.deb ... Unpacking libcom-err2:armhf (1.47.0-2.4) ... Selecting previously unselected package libk5crypto3:armhf. Preparing to unpack .../019-libk5crypto3_1.20.1-6+b1_armhf.deb ... Unpacking libk5crypto3:armhf (1.20.1-6+b1) ... Selecting previously unselected package libkeyutils1:armhf. Preparing to unpack .../020-libkeyutils1_1.6.3-3_armhf.deb ... Unpacking libkeyutils1:armhf (1.6.3-3) ... Selecting previously unselected package libkrb5-3:armhf. Preparing to unpack .../021-libkrb5-3_1.20.1-6+b1_armhf.deb ... Unpacking libkrb5-3:armhf (1.20.1-6+b1) ... Selecting previously unselected package libgssapi-krb5-2:armhf. Preparing to unpack .../022-libgssapi-krb5-2_1.20.1-6+b1_armhf.deb ... Unpacking libgssapi-krb5-2:armhf (1.20.1-6+b1) ... Selecting previously unselected package openssh-client. Preparing to unpack .../023-openssh-client_1%3a9.7p1-4_armhf.deb ... Unpacking openssh-client (1:9.7p1-4) ... Selecting previously unselected package ucf. Preparing to unpack .../024-ucf_3.0043+nmu1_all.deb ... Moving old data out of the way Unpacking ucf (3.0043+nmu1) ... Selecting previously unselected package amap-align. Preparing to unpack .../025-amap-align_2.2+git20080214.600fc29+dfsg-2_armhf.deb ... Unpacking amap-align (2.2+git20080214.600fc29+dfsg-2) ... Selecting previously unselected package m4. Preparing to unpack .../026-m4_1.4.19-4_armhf.deb ... Unpacking m4 (1.4.19-4) ... Selecting previously unselected package autoconf. Preparing to unpack .../027-autoconf_2.71-3_all.deb ... Unpacking autoconf (2.71-3) ... Selecting previously unselected package autotools-dev. Preparing to unpack .../028-autotools-dev_20220109.1_all.deb ... Unpacking autotools-dev (20220109.1) ... Selecting previously unselected package automake. Preparing to unpack .../029-automake_1%3a1.16.5-1.3_all.deb ... Unpacking automake (1:1.16.5-1.3) ... Selecting previously unselected package autopoint. Preparing to unpack .../030-autopoint_0.21-14_all.deb ... Unpacking autopoint (0.21-14) ... Selecting previously unselected package bedtools-test. Preparing to unpack .../031-bedtools-test_2.31.1+dfsg-2_all.deb ... Unpacking bedtools-test (2.31.1+dfsg-2) ... Selecting previously unselected package libio-string-perl. Preparing to unpack .../032-libio-string-perl_1.08-4_all.deb ... Unpacking libio-string-perl (1.08-4) ... Selecting previously unselected package libdata-stag-perl. Preparing to unpack .../033-libdata-stag-perl_0.14-3_all.deb ... Unpacking libdata-stag-perl (0.14-3) ... Selecting previously unselected package libbio-perl-perl. Preparing to unpack .../034-libbio-perl-perl_1.7.8-1_all.deb ... Unpacking libbio-perl-perl (1.7.8-1) ... Selecting previously unselected package libclass-data-inheritable-perl. Preparing to unpack .../035-libclass-data-inheritable-perl_0.08-3_all.deb ... Unpacking libclass-data-inheritable-perl (0.08-3) ... Selecting previously unselected package libdevel-stacktrace-perl. Preparing to unpack .../036-libdevel-stacktrace-perl_2.0500-1_all.deb ... Unpacking libdevel-stacktrace-perl (2.0500-1) ... Selecting previously unselected package libexception-class-perl. Preparing to unpack .../037-libexception-class-perl_1.45-1_all.deb ... Unpacking libexception-class-perl (1.45-1) ... Selecting previously unselected package libtest-deep-perl. Preparing to unpack .../038-libtest-deep-perl_1.204-1_all.deb ... Unpacking libtest-deep-perl (1.204-1) ... Selecting previously unselected package libcapture-tiny-perl. Preparing to unpack .../039-libcapture-tiny-perl_0.48-2_all.deb ... Unpacking libcapture-tiny-perl (0.48-2) ... Selecting previously unselected package libalgorithm-diff-perl. Preparing to unpack .../040-libalgorithm-diff-perl_1.201-1_all.deb ... Unpacking libalgorithm-diff-perl (1.201-1) ... Selecting previously unselected package libtext-diff-perl. Preparing to unpack .../041-libtext-diff-perl_1.45-2_all.deb ... Unpacking libtext-diff-perl (1.45-2) ... Selecting previously unselected package libtest-differences-perl. Preparing to unpack .../042-libtest-differences-perl_0.71-1_all.deb ... Unpacking libtest-differences-perl (0.71-1) ... Selecting previously unselected package libsub-uplevel-perl. Preparing to unpack .../043-libsub-uplevel-perl_0.2800-3_all.deb ... Unpacking libsub-uplevel-perl (0.2800-3) ... Selecting previously unselected package libtest-exception-perl. Preparing to unpack .../044-libtest-exception-perl_0.43-3_all.deb ... Unpacking libtest-exception-perl (0.43-3) ... Selecting previously unselected package libtest-warn-perl. Preparing to unpack .../045-libtest-warn-perl_0.37-2_all.deb ... Unpacking libtest-warn-perl (0.37-2) ... Selecting previously unselected package libtest-most-perl. Preparing to unpack .../046-libtest-most-perl_0.38-1_all.deb ... Unpacking libtest-most-perl (0.38-1) ... Selecting previously unselected package bioperl. Preparing to unpack .../047-bioperl_1.7.8-1_all.deb ... Unpacking bioperl (1.7.8-1) ... Selecting previously unselected package libdebhelper-perl. Preparing to unpack .../048-libdebhelper-perl_13.15.3_all.deb ... Unpacking libdebhelper-perl (13.15.3) ... Selecting previously unselected package libtool. Preparing to unpack .../049-libtool_2.4.7-7_all.deb ... Unpacking libtool (2.4.7-7) ... Selecting previously unselected package dh-autoreconf. Preparing to unpack .../050-dh-autoreconf_20_all.deb ... Unpacking dh-autoreconf (20) ... Selecting previously unselected package libarchive-zip-perl. Preparing to unpack .../051-libarchive-zip-perl_1.68-1_all.deb ... Unpacking libarchive-zip-perl (1.68-1) ... Selecting previously unselected package libsub-override-perl. Preparing to unpack .../052-libsub-override-perl_0.10-1_all.deb ... Unpacking libsub-override-perl (0.10-1) ... Selecting previously unselected package libfile-stripnondeterminism-perl. Preparing to unpack .../053-libfile-stripnondeterminism-perl_1.13.1-1_all.deb ... Unpacking libfile-stripnondeterminism-perl (1.13.1-1) ... Selecting previously unselected package dh-strip-nondeterminism. Preparing to unpack .../054-dh-strip-nondeterminism_1.13.1-1_all.deb ... Unpacking dh-strip-nondeterminism (1.13.1-1) ... Selecting previously unselected package libelf1t64:armhf. Preparing to unpack .../055-libelf1t64_0.191-1+b1_armhf.deb ... Unpacking libelf1t64:armhf (0.191-1+b1) ... Selecting previously unselected package dwz. Preparing to unpack .../056-dwz_0.15-1+b2_armhf.deb ... Unpacking dwz (0.15-1+b2) ... Selecting previously unselected package libicu72:armhf. Preparing to unpack .../057-libicu72_72.1-4+b1_armhf.deb ... Unpacking libicu72:armhf (72.1-4+b1) ... Selecting previously unselected package libxml2:armhf. Preparing to unpack .../058-libxml2_2.9.14+dfsg-1.3+b3_armhf.deb ... Unpacking libxml2:armhf (2.9.14+dfsg-1.3+b3) ... Selecting previously unselected package gettext. Preparing to unpack .../059-gettext_0.21-14+b1_armhf.deb ... Unpacking gettext (0.21-14+b1) ... Selecting previously unselected package intltool-debian. Preparing to unpack .../060-intltool-debian_0.35.0+20060710.6_all.deb ... Unpacking intltool-debian (0.35.0+20060710.6) ... Selecting previously unselected package po-debconf. Preparing to unpack .../061-po-debconf_1.0.21+nmu1_all.deb ... Unpacking po-debconf (1.0.21+nmu1) ... Selecting previously unselected package debhelper. Preparing to unpack .../062-debhelper_13.15.3_all.deb ... Unpacking debhelper (13.15.3) ... Selecting previously unselected package libglib2.0-0t64:armhf. Preparing to unpack .../063-libglib2.0-0t64_2.78.4-7_armhf.deb ... Unpacking libglib2.0-0t64:armhf (2.78.4-7) ... Selecting previously unselected package exonerate. Preparing to unpack .../064-exonerate_2.4.0-5+b1_armhf.deb ... Unpacking exonerate (2.4.0-5+b1) ... Selecting previously unselected package fasttree. Preparing to unpack .../065-fasttree_2.1.11-2_armhf.deb ... Unpacking fasttree (2.1.11-2) ... Selecting previously unselected package hyphy-common. Preparing to unpack .../066-hyphy-common_2.5.60+dfsg-1_all.deb ... Unpacking hyphy-common (2.5.60+dfsg-1) ... Selecting previously unselected package libbrotli1:armhf. Preparing to unpack .../067-libbrotli1_1.1.0-2+b3_armhf.deb ... Unpacking libbrotli1:armhf (1.1.0-2+b3) ... Selecting previously unselected package libnghttp2-14:armhf. Preparing to unpack .../068-libnghttp2-14_1.61.0-1+b1_armhf.deb ... Unpacking libnghttp2-14:armhf (1.61.0-1+b1) ... Selecting previously unselected package libpsl5t64:armhf. Preparing to unpack .../069-libpsl5t64_0.21.2-1.1_armhf.deb ... Unpacking libpsl5t64:armhf (0.21.2-1.1) ... Selecting previously unselected package librtmp1:armhf. Preparing to unpack .../070-librtmp1_2.4+20151223.gitfa8646d.1-2+b4_armhf.deb ... Unpacking librtmp1:armhf (2.4+20151223.gitfa8646d.1-2+b4) ... Selecting previously unselected package libssh2-1t64:armhf. Preparing to unpack .../071-libssh2-1t64_1.11.0-4.1+b2_armhf.deb ... Unpacking libssh2-1t64:armhf (1.11.0-4.1+b2) ... Selecting previously unselected package libcurl3t64-gnutls:armhf. Preparing to unpack .../072-libcurl3t64-gnutls_8.7.1-3_armhf.deb ... Unpacking libcurl3t64-gnutls:armhf (8.7.1-3) ... Selecting previously unselected package hyphy-pt. Preparing to unpack .../073-hyphy-pt_2.5.60+dfsg-1_armhf.deb ... Unpacking hyphy-pt (2.5.60+dfsg-1) ... Selecting previously unselected package kalign. Preparing to unpack .../074-kalign_1%3a3.4.0-1_armhf.deb ... Unpacking kalign (1:3.4.0-1) ... Selecting previously unselected package lagan. Preparing to unpack .../075-lagan_2.0-10_armhf.deb ... Unpacking lagan (2.0-10) ... Selecting previously unselected package libclass-method-modifiers-perl. Preparing to unpack .../076-libclass-method-modifiers-perl_2.15-1_all.deb ... Unpacking libclass-method-modifiers-perl (2.15-1) ... Selecting previously unselected package libclass-xsaccessor-perl. Preparing to unpack .../077-libclass-xsaccessor-perl_1.19-4+b3_armhf.deb ... Unpacking libclass-xsaccessor-perl (1.19-4+b3) ... Selecting previously unselected package libb-hooks-op-check-perl:armhf. Preparing to unpack .../078-libb-hooks-op-check-perl_0.22-3+b1_armhf.deb ... Unpacking libb-hooks-op-check-perl:armhf (0.22-3+b1) ... Selecting previously unselected package libdynaloader-functions-perl. Preparing to unpack .../079-libdynaloader-functions-perl_0.003-3_all.deb ... Unpacking libdynaloader-functions-perl (0.003-3) ... Selecting previously unselected package libdevel-callchecker-perl:armhf. Preparing to unpack .../080-libdevel-callchecker-perl_0.008-2+b2_armhf.deb ... Unpacking libdevel-callchecker-perl:armhf (0.008-2+b2) ... Selecting previously unselected package libparams-classify-perl:armhf. Preparing to unpack .../081-libparams-classify-perl_0.015-2+b3_armhf.deb ... Unpacking libparams-classify-perl:armhf (0.015-2+b3) ... Selecting previously unselected package libmodule-runtime-perl. Preparing to unpack .../082-libmodule-runtime-perl_0.016-2_all.deb ... Unpacking libmodule-runtime-perl (0.016-2) ... Selecting previously unselected package libimport-into-perl. Preparing to unpack .../083-libimport-into-perl_1.002005-2_all.deb ... Unpacking libimport-into-perl (1.002005-2) ... Selecting previously unselected package librole-tiny-perl. Preparing to unpack .../084-librole-tiny-perl_2.002004-1_all.deb ... Unpacking librole-tiny-perl (2.002004-1) ... Selecting previously unselected package libsub-quote-perl. Preparing to unpack .../085-libsub-quote-perl_2.006008-1_all.deb ... Unpacking libsub-quote-perl (2.006008-1) ... Selecting previously unselected package libmoo-perl. Preparing to unpack .../086-libmoo-perl_2.005005-1_all.deb ... Unpacking libmoo-perl (2.005005-1) ... Selecting previously unselected package libexporter-tiny-perl. Preparing to unpack .../087-libexporter-tiny-perl_1.006002-1_all.deb ... Unpacking libexporter-tiny-perl (1.006002-1) ... Selecting previously unselected package libtype-tiny-perl. Preparing to unpack .../088-libtype-tiny-perl_2.004000-1_all.deb ... Unpacking libtype-tiny-perl (2.004000-1) ... Selecting previously unselected package libarray-compare-perl. Preparing to unpack .../089-libarray-compare-perl_3.0.8-1_all.deb ... Unpacking libarray-compare-perl (3.0.8-1) ... Selecting previously unselected package liburi-perl. Preparing to unpack .../090-liburi-perl_5.28-1_all.deb ... Unpacking liburi-perl (5.28-1) ... Selecting previously unselected package libencode-locale-perl. Preparing to unpack .../091-libencode-locale-perl_1.05-3_all.deb ... Unpacking libencode-locale-perl (1.05-3) ... Selecting previously unselected package libtimedate-perl. Preparing to unpack .../092-libtimedate-perl_2.3300-2_all.deb ... Unpacking libtimedate-perl (2.3300-2) ... Selecting previously unselected package libhttp-date-perl. Preparing to unpack .../093-libhttp-date-perl_6.06-1_all.deb ... Unpacking libhttp-date-perl (6.06-1) ... Selecting previously unselected package libfile-listing-perl. Preparing to unpack .../094-libfile-listing-perl_6.16-1_all.deb ... Unpacking libfile-listing-perl (6.16-1) ... Selecting previously unselected package libhtml-tagset-perl. Preparing to unpack .../095-libhtml-tagset-perl_3.24-1_all.deb ... Unpacking libhtml-tagset-perl (3.24-1) ... Selecting previously unselected package libhtml-parser-perl:armhf. Preparing to unpack .../096-libhtml-parser-perl_3.82-1_armhf.deb ... Unpacking libhtml-parser-perl:armhf (3.82-1) ... Selecting previously unselected package libhtml-tree-perl. Preparing to unpack .../097-libhtml-tree-perl_5.07-3_all.deb ... Unpacking libhtml-tree-perl (5.07-3) ... Selecting previously unselected package libclone-perl:armhf. Preparing to unpack .../098-libclone-perl_0.46-1+b2_armhf.deb ... Unpacking libclone-perl:armhf (0.46-1+b2) ... Selecting previously unselected package libio-html-perl. Preparing to unpack .../099-libio-html-perl_1.004-3_all.deb ... Unpacking libio-html-perl (1.004-3) ... Selecting previously unselected package liblwp-mediatypes-perl. Preparing to unpack .../100-liblwp-mediatypes-perl_6.04-2_all.deb ... Unpacking liblwp-mediatypes-perl (6.04-2) ... Selecting previously unselected package libhttp-message-perl. Preparing to unpack .../101-libhttp-message-perl_6.45-1_all.deb ... Unpacking libhttp-message-perl (6.45-1) ... Selecting previously unselected package libhttp-cookies-perl. Preparing to unpack .../102-libhttp-cookies-perl_6.11-1_all.deb ... Unpacking libhttp-cookies-perl (6.11-1) ... Selecting previously unselected package libhttp-negotiate-perl. Preparing to unpack .../103-libhttp-negotiate-perl_6.01-2_all.deb ... Unpacking libhttp-negotiate-perl (6.01-2) ... Selecting previously unselected package perl-openssl-defaults:armhf. Preparing to unpack .../104-perl-openssl-defaults_7+b2_armhf.deb ... Unpacking perl-openssl-defaults:armhf (7+b2) ... Selecting previously unselected package libnet-ssleay-perl:armhf. Preparing to unpack .../105-libnet-ssleay-perl_1.94-1+b1_armhf.deb ... Unpacking libnet-ssleay-perl:armhf (1.94-1+b1) ... Selecting previously unselected package libio-socket-ssl-perl. Preparing to unpack .../106-libio-socket-ssl-perl_2.085-1_all.deb ... Unpacking libio-socket-ssl-perl (2.085-1) ... Selecting previously unselected package libnet-http-perl. Preparing to unpack .../107-libnet-http-perl_6.23-1_all.deb ... Unpacking libnet-http-perl (6.23-1) ... Selecting previously unselected package liblwp-protocol-https-perl. Preparing to unpack .../108-liblwp-protocol-https-perl_6.14-1_all.deb ... Unpacking liblwp-protocol-https-perl (6.14-1) ... Selecting previously unselected package libtry-tiny-perl. Preparing to unpack .../109-libtry-tiny-perl_0.31-2_all.deb ... Unpacking libtry-tiny-perl (0.31-2) ... Selecting previously unselected package libwww-robotrules-perl. Preparing to unpack .../110-libwww-robotrules-perl_6.02-1_all.deb ... Unpacking libwww-robotrules-perl (6.02-1) ... Selecting previously unselected package libwww-perl. Preparing to unpack .../111-libwww-perl_6.77-1_all.deb ... Unpacking libwww-perl (6.77-1) ... Selecting previously unselected package libxml-parser-perl. Preparing to unpack .../112-libxml-parser-perl_2.47-1+b2_armhf.deb ... Unpacking libxml-parser-perl (2.47-1+b2) ... Selecting previously unselected package libxml-twig-perl. Preparing to unpack .../113-libxml-twig-perl_1%3a3.52-3_all.deb ... Unpacking libxml-twig-perl (1:3.52-3) ... Selecting previously unselected package libxml-writer-perl. Preparing to unpack .../114-libxml-writer-perl_0.900-2_all.deb ... Unpacking libxml-writer-perl (0.900-2) ... Selecting previously unselected package libbio-variation-perl. Preparing to unpack .../115-libbio-variation-perl_1.7.5-3_all.deb ... Unpacking libbio-variation-perl (1.7.5-3) ... Selecting previously unselected package libxml-namespacesupport-perl. Preparing to unpack .../116-libxml-namespacesupport-perl_1.12-2_all.deb ... Unpacking libxml-namespacesupport-perl (1.12-2) ... Selecting previously unselected package libxml-sax-base-perl. Preparing to unpack .../117-libxml-sax-base-perl_1.09-3_all.deb ... Unpacking libxml-sax-base-perl (1.09-3) ... Selecting previously unselected package libxml-sax-perl. Preparing to unpack .../118-libxml-sax-perl_1.02+dfsg-3_all.deb ... Unpacking libxml-sax-perl (1.02+dfsg-3) ... Selecting previously unselected package libbio-cluster-perl. Preparing to unpack .../119-libbio-cluster-perl_1.7.3-6_all.deb ... Unpacking libbio-cluster-perl (1.7.3-6) ... Selecting previously unselected package libbio-asn1-entrezgene-perl. Preparing to unpack .../120-libbio-asn1-entrezgene-perl_1.730-3_all.deb ... Unpacking libbio-asn1-entrezgene-perl (1.730-3) ... Selecting previously unselected package libtext-csv-perl. Preparing to unpack .../121-libtext-csv-perl_2.04-1_all.deb ... Unpacking libtext-csv-perl (2.04-1) ... Selecting previously unselected package libxml-libxml-perl. Preparing to unpack .../122-libxml-libxml-perl_2.0207+dfsg+really+2.0134-1+b4_armhf.deb ... Unpacking libxml-libxml-perl (2.0207+dfsg+really+2.0134-1+b4) ... Selecting previously unselected package libxml-simple-perl. Preparing to unpack .../123-libxml-simple-perl_2.25-2_all.deb ... Unpacking libxml-simple-perl (2.25-2) ... Selecting previously unselected package libbio-eutilities-perl. Preparing to unpack .../124-libbio-eutilities-perl_1.77-2_all.deb ... Unpacking libbio-eutilities-perl (1.77-2) ... Selecting previously unselected package libfile-slurp-tiny-perl. Preparing to unpack .../125-libfile-slurp-tiny-perl_0.004-2_all.deb ... Unpacking libfile-slurp-tiny-perl (0.004-2) ... Selecting previously unselected package libtree-dagnode-perl. Preparing to unpack .../126-libtree-dagnode-perl_1.32-1_all.deb ... Unpacking libtree-dagnode-perl (1.32-1) ... Selecting previously unselected package libxml-perl. Preparing to unpack .../127-libxml-perl_0.08-4_all.deb ... Unpacking libxml-perl (0.08-4) ... Selecting previously unselected package libxml-regexp-perl. Preparing to unpack .../128-libxml-regexp-perl_0.04-1.1_all.deb ... Unpacking libxml-regexp-perl (0.04-1.1) ... Selecting previously unselected package libxml-dom-perl. Preparing to unpack .../129-libxml-dom-perl_1.46-2_all.deb ... Unpacking libxml-dom-perl (1.46-2) ... Selecting previously unselected package libxml-xpathengine-perl. Preparing to unpack .../130-libxml-xpathengine-perl_0.14-2_all.deb ... Unpacking libxml-xpathengine-perl (0.14-2) ... Selecting previously unselected package libxml-dom-xpath-perl. Preparing to unpack .../131-libxml-dom-xpath-perl_0.14-4_all.deb ... Unpacking libxml-dom-xpath-perl (0.14-4) ... Selecting previously unselected package libbio-featureio-perl. Preparing to unpack .../132-libbio-featureio-perl_1.6.905-2_all.deb ... Unpacking libbio-featureio-perl (1.6.905-2) ... Selecting previously unselected package libbio-tools-run-remoteblast-perl. Preparing to unpack .../133-libbio-tools-run-remoteblast-perl_1.7.3-3_all.deb ... Unpacking libbio-tools-run-remoteblast-perl (1.7.3-3) ... Selecting previously unselected package libmodule-pluggable-perl. Preparing to unpack .../134-libmodule-pluggable-perl_5.2-5_all.deb ... Unpacking libmodule-pluggable-perl (5.2-5) ... Selecting previously unselected package libconfig-any-perl. Preparing to unpack .../135-libconfig-any-perl_0.33-1_all.deb ... Unpacking libconfig-any-perl (0.33-1) ... Selecting previously unselected package libevent-core-2.1-7t64:armhf. Preparing to unpack .../136-libevent-core-2.1-7t64_2.1.12-stable-8.1+b3_armhf.deb ... Unpacking libevent-core-2.1-7t64:armhf (2.1.12-stable-8.1+b3) ... Selecting previously unselected package libevent-pthreads-2.1-7t64:armhf. Preparing to unpack .../137-libevent-pthreads-2.1-7t64_2.1.12-stable-8.1+b3_armhf.deb ... Unpacking libevent-pthreads-2.1-7t64:armhf (2.1.12-stable-8.1+b3) ... Selecting previously unselected package libnl-3-200:armhf. Preparing to unpack .../138-libnl-3-200_3.7.0-0.3_armhf.deb ... Unpacking libnl-3-200:armhf (3.7.0-0.3) ... Selecting previously unselected package libnl-route-3-200:armhf. Preparing to unpack .../139-libnl-route-3-200_3.7.0-0.3_armhf.deb ... Unpacking libnl-route-3-200:armhf (3.7.0-0.3) ... Selecting previously unselected package libibverbs1:armhf. Preparing to unpack .../140-libibverbs1_50.0-2+b1_armhf.deb ... Unpacking libibverbs1:armhf (50.0-2+b1) ... Selecting previously unselected package librdmacm1t64:armhf. Preparing to unpack .../141-librdmacm1t64_50.0-2+b1_armhf.deb ... Unpacking librdmacm1t64:armhf (50.0-2+b1) ... Selecting previously unselected package libfabric1:armhf. Preparing to unpack .../142-libfabric1_1.17.0-3+b1_armhf.deb ... Unpacking libfabric1:armhf (1.17.0-3+b1) ... Selecting previously unselected package libfile-sort-perl. Preparing to unpack .../143-libfile-sort-perl_1.01-3_all.deb ... Unpacking libfile-sort-perl (1.01-3) ... Selecting previously unselected package libpciaccess0:armhf. Preparing to unpack .../144-libpciaccess0_0.17-3+b1_armhf.deb ... Unpacking libpciaccess0:armhf (0.17-3+b1) ... Selecting previously unselected package libxau6:armhf. Preparing to unpack .../145-libxau6_1%3a1.0.9-1+b1_armhf.deb ... Unpacking libxau6:armhf (1:1.0.9-1+b1) ... Selecting previously unselected package libxdmcp6:armhf. Preparing to unpack .../146-libxdmcp6_1%3a1.1.2-3+b1_armhf.deb ... Unpacking libxdmcp6:armhf (1:1.1.2-3+b1) ... Selecting previously unselected package libxcb1:armhf. Preparing to unpack .../147-libxcb1_1.17.0-1_armhf.deb ... Unpacking libxcb1:armhf (1.17.0-1) ... Selecting previously unselected package libx11-data. Preparing to unpack .../148-libx11-data_2%3a1.8.7-1_all.deb ... Unpacking libx11-data (2:1.8.7-1) ... Selecting previously unselected package libx11-6:armhf. Preparing to unpack .../149-libx11-6_2%3a1.8.7-1_armhf.deb ... Unpacking libx11-6:armhf (2:1.8.7-1) ... Selecting previously unselected package libxext6:armhf. Preparing to unpack .../150-libxext6_2%3a1.3.4-1+b1_armhf.deb ... Unpacking libxext6:armhf (2:1.3.4-1+b1) ... Selecting previously unselected package libxnvctrl0:armhf. Preparing to unpack .../151-libxnvctrl0_535.171.04-1_armhf.deb ... Unpacking libxnvctrl0:armhf (535.171.04-1) ... Selecting previously unselected package ocl-icd-libopencl1:armhf. Preparing to unpack .../152-ocl-icd-libopencl1_2.3.2-1+b1_armhf.deb ... Unpacking ocl-icd-libopencl1:armhf (2.3.2-1+b1) ... Selecting previously unselected package libhwloc15:armhf. Preparing to unpack .../153-libhwloc15_2.10.0-1+b1_armhf.deb ... Unpacking libhwloc15:armhf (2.10.0-1+b1) ... Selecting previously unselected package libhwloc-plugins:armhf. Preparing to unpack .../154-libhwloc-plugins_2.10.0-1+b1_armhf.deb ... Unpacking libhwloc-plugins:armhf (2.10.0-1+b1) ... Selecting previously unselected package libio-pty-perl. Preparing to unpack .../155-libio-pty-perl_1%3a1.20-1+b1_armhf.deb ... Unpacking libio-pty-perl (1:1.20-1+b1) ... Selecting previously unselected package libipc-run-perl. Preparing to unpack .../156-libipc-run-perl_20231003.0-2_all.deb ... Unpacking libipc-run-perl (20231003.0-2) ... Selecting previously unselected package liblmdb0:armhf. Preparing to unpack .../157-liblmdb0_0.9.31-1+b1_armhf.deb ... Unpacking liblmdb0:armhf (0.9.31-1+b1) ... Selecting previously unselected package libmbedcrypto7t64:armhf. Preparing to unpack .../158-libmbedcrypto7t64_2.28.8-1_armhf.deb ... Unpacking libmbedcrypto7t64:armhf (2.28.8-1) ... Selecting previously unselected package libmbedx509-1t64:armhf. Preparing to unpack .../159-libmbedx509-1t64_2.28.8-1_armhf.deb ... Unpacking libmbedx509-1t64:armhf (2.28.8-1) ... Selecting previously unselected package libmbedtls14t64:armhf. Preparing to unpack .../160-libmbedtls14t64_2.28.8-1_armhf.deb ... Unpacking libmbedtls14t64:armhf (2.28.8-1) ... Selecting previously unselected package libmodule-build-perl. Preparing to unpack .../161-libmodule-build-perl_0.423400-2_all.deb ... Adding 'diversion of /usr/bin/config_data to /usr/bin/config_data.diverted by libmodule-build-perl' Adding 'diversion of /usr/share/man/man1/config_data.1.gz to /usr/share/man/man1/config_data.diverted.1.gz by libmodule-build-perl' Unpacking libmodule-build-perl (0.423400-2) ... Selecting previously unselected package libopenmpi3t64:armhf. Preparing to unpack .../162-libopenmpi3t64_4.1.6-13_armhf.deb ... Unpacking libopenmpi3t64:armhf (4.1.6-13) ... Selecting previously unselected package mafft. Preparing to unpack .../163-mafft_7.505-1_armhf.deb ... Unpacking mafft (7.505-1) ... Selecting previously unselected package muscle. Preparing to unpack .../164-muscle_1%3a5.1.0-1_armhf.deb ... Unpacking muscle (1:5.1.0-1) ... Selecting previously unselected package ncbi-data. Preparing to unpack .../165-ncbi-data_6.1.20170106+dfsg2-2_all.deb ... Unpacking ncbi-data (6.1.20170106+dfsg2-2) ... Selecting previously unselected package ncbi-blast+. Preparing to unpack .../166-ncbi-blast+_2.12.0+ds-4+b1_armhf.deb ... Unpacking ncbi-blast+ (2.12.0+ds-4+b1) ... Selecting previously unselected package ncbi-blast+-legacy. Preparing to unpack .../167-ncbi-blast+-legacy_2.12.0+ds-4_all.deb ... Unpacking ncbi-blast+-legacy (2.12.0+ds-4) ... Selecting previously unselected package ncoils. Preparing to unpack .../168-ncoils_2002-9_armhf.deb ... Unpacking ncoils (2002-9) ... Selecting previously unselected package openmpi-common. Preparing to unpack .../169-openmpi-common_4.1.6-13_all.deb ... Unpacking openmpi-common (4.1.6-13) ... Selecting previously unselected package openmpi-bin. Preparing to unpack .../170-openmpi-bin_4.1.6-13_armhf.deb ... Unpacking openmpi-bin (4.1.6-13) ... Selecting previously unselected package pal2nal. Preparing to unpack .../171-pal2nal_14.1-3_all.deb ... Unpacking pal2nal (14.1-3) ... Selecting previously unselected package phyml. Preparing to unpack .../172-phyml_3%3a3.3.20220408-3+b1_armhf.deb ... Unpacking phyml (3:3.3.20220408-3+b1) ... Selecting previously unselected package primer3. Preparing to unpack .../173-primer3_2.6.1-4_armhf.deb ... Unpacking primer3 (2.6.1-4) ... Selecting previously unselected package probcons. Preparing to unpack .../174-probcons_1.12-14_armhf.deb ... Unpacking probcons (1.12-14) ... Selecting previously unselected package raxml. Preparing to unpack .../175-raxml_8.2.13+dfsg-1_armhf.deb ... Unpacking raxml (8.2.13+dfsg-1) ... Selecting previously unselected package sim4. Preparing to unpack .../176-sim4_0.0.20121010-8_armhf.deb ... Unpacking sim4 (0.0.20121010-8) ... Selecting previously unselected package wise-data. Preparing to unpack .../177-wise-data_2.4.1-24_all.deb ... Unpacking wise-data (2.4.1-24) ... Selecting previously unselected package wise. Preparing to unpack .../178-wise_2.4.1-24_armhf.deb ... Unpacking wise (2.4.1-24) ... Setting up media-types (10.1.0) ... Setting up libmodule-pluggable-perl (5.2-5) ... Setting up libpipeline1:armhf (1.5.7-2) ... Setting up liblmdb0:armhf (0.9.31-1+b1) ... Setting up ncbi-data (6.1.20170106+dfsg2-2) ... Setting up libpciaccess0:armhf (0.17-3+b1) ... Setting up libxau6:armhf (1:1.0.9-1+b1) ... Setting up libkeyutils1:armhf (1.6.3-3) ... Setting up libicu72:armhf (72.1-4+b1) ... Setting up bsdextrautils (2.40-8) ... Setting up probcons (1.12-14) ... Setting up libmbedcrypto7t64:armhf (2.28.8-1) ... Setting up libdynaloader-functions-perl (0.003-3) ... Setting up libtest-deep-perl (1.204-1) ... Setting up libclass-method-modifiers-perl (2.15-1) ... Setting up libxml-regexp-perl (0.04-1.1) ... Setting up libio-pty-perl (1:1.20-1+b1) ... Setting up libmagic-mgc (1:5.45-3) ... Setting up libcbor0.10:armhf (0.10.2-1.2) ... Setting up mafft (7.505-1) ... Setting up libclone-perl:armhf (0.46-1+b2) ... Setting up libalgorithm-diff-perl (1.201-1) ... Setting up libarchive-zip-perl (1.68-1) ... Setting up libhtml-tagset-perl (3.24-1) ... Setting up libdebhelper-perl (13.15.3) ... Setting up libbrotli1:armhf (1.1.0-2+b3) ... Setting up libfile-slurp-tiny-perl (0.004-2) ... Setting up liblwp-mediatypes-perl (6.04-2) ... Setting up libmagic1t64:armhf (1:5.45-3) ... Setting up libtry-tiny-perl (0.31-2) ... Setting up libpsl5t64:armhf (0.21.2-1.1) ... Setting up libnghttp2-14:armhf (1.61.0-1+b1) ... Setting up perl-openssl-defaults:armhf (7+b2) ... Setting up libxml-namespacesupport-perl (1.12-2) ... Setting up gettext-base (0.21-14+b1) ... Setting up m4 (1.4.19-4) ... Setting up libencode-locale-perl (1.05-3) ... Setting up ncoils (2002-9) ... Setting up libcom-err2:armhf (1.47.0-2.4) ... Setting up hyphy-common (2.5.60+dfsg-1) ... Setting up file (1:5.45-3) ... Setting up muscle (1:5.1.0-1) ... Setting up libelf1t64:armhf (0.191-1+b1) ... Setting up libmodule-build-perl (0.423400-2) ... Setting up libkrb5support0:armhf (1.20.1-6+b1) ... Setting up tzdata (2024a-3) ... Current default time zone: 'Etc/UTC' Local time is now: Sun Apr 28 06:25:38 UTC 2024. Universal Time is now: Sun Apr 28 06:25:38 UTC 2024. Run 'dpkg-reconfigure tzdata' if you wish to change it. Setting up libxml-sax-base-perl (1.09-3) ... Setting up libio-string-perl (1.08-4) ... Setting up primer3 (2.6.1-4) ... Setting up kalign (1:3.4.0-1) ... Setting up autotools-dev (20220109.1) ... Setting up libglib2.0-0t64:armhf (2.78.4-7) ... No schema files found: doing nothing. Setting up libclass-data-inheritable-perl (0.08-3) ... Setting up lagan (2.0-10) ... Setting up libx11-data (2:1.8.7-1) ... Setting up libtext-diff-perl (1.45-2) ... Setting up librtmp1:armhf (2.4+20151223.gitfa8646d.1-2+b4) ... Setting up libxml-xpathengine-perl (0.14-2) ... Setting up sim4 (0.0.20121010-8) ... Setting up libxml-writer-perl (0.900-2) ... Setting up libhwloc15:armhf (2.10.0-1+b1) ... Setting up libio-html-perl (1.004-3) ... Setting up autopoint (0.21-14) ... Setting up libb-hooks-op-check-perl:armhf (0.22-3+b1) ... Setting up libipc-run-perl (20231003.0-2) ... Setting up wise-data (2.4.1-24) ... Setting up libk5crypto3:armhf (1.20.1-6+b1) ... Setting up amap-align (2.2+git20080214.600fc29+dfsg-2) ... Setting up autoconf (2.71-3) ... Setting up libcapture-tiny-perl (0.48-2) ... Setting up libtimedate-perl (2.3300-2) ... Setting up libtree-dagnode-perl (1.32-1) ... Setting up dwz (0.15-1+b2) ... Setting up libdata-stag-perl (0.14-3) ... Setting up sensible-utils (0.0.22) ... Setting up ocl-icd-libopencl1:armhf (2.3.2-1+b1) ... Setting up libuchardet0:armhf (0.0.8-1+b1) ... Setting up pal2nal (14.1-3) ... Setting up libnl-3-200:armhf (3.7.0-0.3) ... Setting up librole-tiny-perl (2.002004-1) ... Setting up openmpi-common (4.1.6-13) ... Setting up libconfig-any-perl (0.33-1) ... Setting up libsub-uplevel-perl (0.2800-3) ... Setting up libsub-override-perl (0.10-1) ... Setting up fasttree (2.1.11-2) ... Setting up netbase (6.4) ... Setting up libsub-quote-perl (2.006008-1) ... Setting up libdevel-stacktrace-perl (2.0500-1) ... Setting up libclass-xsaccessor-perl (1.19-4+b3) ... Setting up libkrb5-3:armhf (1.20.1-6+b1) ... Setting up libevent-core-2.1-7t64:armhf (2.1.12-stable-8.1+b3) ... Setting up libbio-perl-perl (1.7.8-1) ... Setting up libssh2-1t64:armhf (1.11.0-4.1+b2) ... Setting up libexporter-tiny-perl (1.006002-1) ... Setting up libfido2-1:armhf (1.14.0-1+b2) ... Setting up openssl (3.2.1-3) ... Setting up libbsd0:armhf (0.12.2-1) ... Setting up readline-common (8.2-4) ... Setting up libxml2:armhf (2.9.14+dfsg-1.3+b3) ... Setting up exonerate (2.4.0-5+b1) ... Setting up liburi-perl (5.28-1) ... Setting up libfile-sort-perl (1.01-3) ... Setting up raxml (8.2.13+dfsg-1) ... Setting up libtext-csv-perl (2.04-1) ... Setting up libnet-ssleay-perl:armhf (1.94-1+b1) ... Setting up automake (1:1.16.5-1.3) ... update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode Setting up libfile-stripnondeterminism-perl (1.13.1-1) ... Setting up libhttp-date-perl (6.06-1) ... Setting up libxdmcp6:armhf (1:1.1.2-3+b1) ... Setting up libxcb1:armhf (1.17.0-1) ... Setting up gettext (0.21-14+b1) ... Setting up libmbedx509-1t64:armhf (2.28.8-1) ... Setting up libfile-listing-perl (6.16-1) ... Setting up libtool (2.4.7-7) ... Setting up libevent-pthreads-2.1-7t64:armhf (2.1.12-stable-8.1+b3) ... Setting up wise (2.4.1-24) ... Setting up libtest-warn-perl (0.37-2) ... Setting up libedit2:armhf (3.1-20230828-1+b1) ... Setting up libtype-tiny-perl (2.004000-1) ... Setting up libtest-differences-perl (0.71-1) ... Setting up libnet-http-perl (6.23-1) ... Setting up libexception-class-perl (1.45-1) ... Setting up libdevel-callchecker-perl:armhf (0.008-2+b2) ... Setting up intltool-debian (0.35.0+20060710.6) ... Setting up libnl-route-3-200:armhf (3.7.0-0.3) ... Setting up dh-autoreconf (20) ... Setting up ca-certificates (20240203) ... Updating certificates in /etc/ssl/certs... 146 added, 0 removed; done. Setting up libtest-exception-perl (0.43-3) ... Setting up libgssapi-krb5-2:armhf (1.20.1-6+b1) ... Setting up ucf (3.0043+nmu1) ... Setting up libreadline8t64:armhf (8.2-4) ... Setting up dh-strip-nondeterminism (1.13.1-1) ... Setting up libwww-robotrules-perl (6.02-1) ... Setting up libmbedtls14t64:armhf (2.28.8-1) ... Setting up groff-base (1.23.0-3+b1) ... Setting up libhtml-parser-perl:armhf (3.82-1) ... Setting up libx11-6:armhf (2:1.8.7-1) ... Setting up libio-socket-ssl-perl (2.085-1) ... Setting up libhttp-message-perl (6.45-1) ... Setting up libhttp-negotiate-perl (6.01-2) ... Setting up libibverbs1:armhf (50.0-2+b1) ... Setting up libhttp-cookies-perl (6.11-1) ... Setting up libtest-most-perl (0.38-1) ... Setting up openssh-client (1:9.7p1-4) ... Setting up po-debconf (1.0.21+nmu1) ... Setting up libhtml-tree-perl (5.07-3) ... Setting up libpython3.11-stdlib:armhf (3.11.9-1) ... Setting up libparams-classify-perl:armhf (0.015-2+b3) ... Setting up libcurl3t64-gnutls:armhf (8.7.1-3) ... Setting up libxext6:armhf (2:1.3.4-1+b1) ... Setting up hyphy-pt (2.5.60+dfsg-1) ... Setting up man-db (2.12.1-1) ... Not building database; man-db/auto-update is not 'true'. Setting up libxml-sax-perl (1.02+dfsg-3) ... update-perl-sax-parsers: Registering Perl SAX parser XML::SAX::PurePerl with priority 10... update-perl-sax-parsers: Updating overall Perl SAX parser modules info file... Creating config file /etc/perl/XML/SAX/ParserDetails.ini with new version Setting up libxnvctrl0:armhf (535.171.04-1) ... Setting up libmodule-runtime-perl (0.016-2) ... Setting up libxml-libxml-perl (2.0207+dfsg+really+2.0134-1+b4) ... update-perl-sax-parsers: Registering Perl SAX parser XML::LibXML::SAX::Parser with priority 50... update-perl-sax-parsers: Registering Perl SAX parser XML::LibXML::SAX with priority 50... update-perl-sax-parsers: Updating overall Perl SAX parser modules info file... Replacing config file /etc/perl/XML/SAX/ParserDetails.ini with new version Setting up librdmacm1t64:armhf (50.0-2+b1) ... Setting up libpython3-stdlib:armhf (3.11.8-1) ... Setting up bioperl (1.7.8-1) ... Setting up libfabric1:armhf (1.17.0-3+b1) ... Setting up python3.11 (3.11.9-1) ... Setting up libimport-into-perl (1.002005-2) ... Setting up libmoo-perl (2.005005-1) ... Setting up debhelper (13.15.3) ... Setting up python3 (3.11.8-1) ... Setting up libhwloc-plugins:armhf (2.10.0-1+b1) ... Setting up ncbi-blast+ (2.12.0+ds-4+b1) ... Setting up libarray-compare-perl (3.0.8-1) ... Setting up libxml-simple-perl (2.25-2) ... Setting up libopenmpi3t64:armhf (4.1.6-13) ... Setting up bedtools-test (2.31.1+dfsg-2) ... Setting up openmpi-bin (4.1.6-13) ... update-alternatives: using /usr/bin/mpirun.openmpi to provide /usr/bin/mpirun (mpirun) in auto mode update-alternatives: using /usr/bin/mpicc.openmpi to provide /usr/bin/mpicc (mpi) in auto mode Setting up phyml (3:3.3.20220408-3+b1) ... Setting up ncbi-blast+-legacy (2.12.0+ds-4) ... Setting up liblwp-protocol-https-perl (6.14-1) ... Setting up libwww-perl (6.77-1) ... Setting up libbio-tools-run-remoteblast-perl (1.7.3-3) ... Setting up libxml-parser-perl (2.47-1+b2) ... Setting up libxml-twig-perl (1:3.52-3) ... Setting up libbio-variation-perl (1.7.5-3) ... Setting up libxml-perl (0.08-4) ... Setting up libbio-cluster-perl (1.7.3-6) ... Setting up libxml-dom-perl (1.46-2) ... Setting up libbio-asn1-entrezgene-perl (1.730-3) ... Setting up libxml-dom-xpath-perl (0.14-4) ... Setting up libbio-eutilities-perl (1.77-2) ... Setting up libbio-featureio-perl (1.6.905-2) ... Processing triggers for libc-bin (2.37-18) ... Processing triggers for ca-certificates (20240203) ... Updating certificates in /etc/ssl/certs... 0 added, 0 removed; done. Running hooks in /etc/ca-certificates/update.d... done. Reading package lists... Building dependency tree... Reading state information... Reading extended state information... Initializing package states... Writing extended state information... Building tag database... -> Finished parsing the build-deps I: Building the package I: user script /srv/workspace/pbuilder/10412/tmp/hooks/A99_set_merged_usr starting Not re-configuring usrmerge for unstable I: user script /srv/workspace/pbuilder/10412/tmp/hooks/A99_set_merged_usr finished hostname: Name or service not known I: Running cd /build/reproducible-path/bioperl-run-1.7.3/ && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path" HOME="/nonexistent/second-build" dpkg-buildpackage -us -uc -b && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path" HOME="/nonexistent/second-build" dpkg-genchanges -S > ../bioperl-run_1.7.3-11_source.changes dpkg-buildpackage: info: source package bioperl-run dpkg-buildpackage: info: source version 1.7.3-11 dpkg-buildpackage: info: source distribution unstable dpkg-buildpackage: info: source changed by Étienne Mollier dpkg-source --before-build . dpkg-buildpackage: info: host architecture armhf debian/rules clean dh clean dh_clean debian/rules binary dh binary dh_update_autotools_config dh_autoreconf debian/rules override_dh_auto_configure make[1]: Entering directory '/build/reproducible-path/bioperl-run-1.7.3' dh_auto_configure -- --install_scripts /usr/bin/perl Build.PL --installdirs vendor --config "optimize=-g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/bioperl-run-1.7.3=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2" --config "ld=arm-linux-gnueabihf-gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/bioperl-run-1.7.3=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -Wl,-z,relro" --install_scripts Do you want to run tests that require connection to servers across the internet (likely to cause some failures)? y/n [n ]n Can't find dist packages without a MANIFEST file Run 'Build manifest' to generate one WARNING: Possible missing or corrupt 'MANIFEST' file. Nothing to enter for 'provides' field in metafile. - will not run internet-requiring tests Created MYMETA.yml and MYMETA.json Creating new 'Build' script for 'BioPerl-Run' version '1.007003' make[1]: Leaving directory '/build/reproducible-path/bioperl-run-1.7.3' dh_auto_build /usr/bin/perl Build Building BioPerl-Run debian/rules override_dh_auto_test make[1]: Entering directory '/build/reproducible-path/bioperl-run-1.7.3' mkdir t.skip for t in Blat Eponine Glimmer2 RepeatMasker Phyml Hyphy MCS ; do mv t/${t}.t t.skip ; done PATH=$PATH:/usr/lib/emboss:/usr/lib/phylip/bin/:/usr/lib/tigr-glimmer:debian/test_hack_bin \ PHYLIPDIR=/usr/lib/phylip/bin HOME_4_TCOFFEE=/tmp COILSDIR=/usr/share/ncoils/ \ dh_auto_test --no-parallel /usr/bin/perl Build test --verbose 1 AMAP version AMAP.2.2 - align multiple protein sequences and print to standard output PROBCONS Written by Chuong Do AMAP algorithm implemented by Ariel Schwartz Using parameter set: initDistrib[] = { 0.400000006 0.3000000119 0.3000000119 } gapOpen[] = { 0.01993141696 0.01993141696 } gapExtend[] = { 0.7943345308 0.7943345308 } Loading sequence file: t/data/cysprot.fa Computing posterior matrices Building DAG Starting the sequence annealing process Creating candidate edge list Adding edges to the DAG AMAP version AMAP.2.2 - align multiple protein sequences and print to standard output PROBCONS Written by Chuong Do AMAP algorithm implemented by Ariel Schwartz Using parameter set: initDistrib[] = { 0.400000006 0.3000000119 0.3000000119 } gapOpen[] = { 0.01993141696 0.01993141696 } gapExtend[] = { 0.7943345308 0.7943345308 } Loading sequence file: /tmp/AFEJaGLKl4 Computing posterior matrices Building DAG Starting the sequence annealing process Creating candidate edge list Adding edges to the DAG t/Amap.t ...................... 1..18 ok 1 - use Bio::Tools::Run::Alignment::Amap; ok 2 - use Bio::SeqIO; ok 3 - use File::Spec; ok 4 - Found input file ok 5 - An object of class 'Bio::Tools::Run::Alignment::Amap' isa 'Bio::Tools::Run::Alignment::Amap' ok 6 - program_dir returned correct default ok 7 - error_string returned correct default ok 8 - aformat returned correct default ok 9 - outfile_name returned correct default ok 10 - Correct exe default name ok 11 - Correct minimum program version ok 12 - No error occured ok 13 - outfile_name returned something ok 14 - An object of class 'Bio::SimpleAlign' isa 'Bio::SimpleAlign' ok 15 - Correct number of seqs returned ok 16 - An object of class 'Bio::SimpleAlign' isa 'Bio::SimpleAlign' ok 17 - Correct number of seqs returned ok 18 - Got the correct ave % identity ok # Required executable for Bio::Tools::Run::BEDTools is not present t/BEDTools.t .................. 1..423 ok 1 - make a default factory ok 2 - default to command 'bam_to_bed' ok 3 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 4 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 5 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 6 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 7 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 8 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 9 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 10 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 11 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 12 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 13 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 14 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 15 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 16 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 17 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 18 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 19 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 20 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 21 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 22 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 23 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 24 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 25 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 26 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 27 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 28 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 29 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 30 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 31 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 32 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 33 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 34 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 35 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 36 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 37 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 38 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 39 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 40 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 41 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 42 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 43 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 44 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 45 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 46 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 47 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 48 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 49 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 50 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 51 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 52 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 53 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 54 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 55 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 56 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 57 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 58 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 59 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 60 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 61 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 62 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 63 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 64 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 65 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 66 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 67 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 68 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 69 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 70 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 71 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 72 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 73 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 74 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 75 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 76 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 77 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 78 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 79 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 80 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 81 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 82 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 83 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 84 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 85 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 86 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 87 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 88 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 89 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 90 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 91 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 92 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 93 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 94 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 95 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 96 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 97 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 98 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 99 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 100 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 101 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 102 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 103 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 104 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 105 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 106 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 107 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 108 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 109 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 110 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 111 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 112 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 113 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 114 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 115 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 116 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 117 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 118 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 119 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 120 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 121 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 122 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 123 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 124 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 125 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 126 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 127 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 128 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 129 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 130 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 131 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 132 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 133 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 134 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 135 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 136 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 137 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 138 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 139 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 140 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 141 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 142 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 143 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 144 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 145 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 146 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 147 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 148 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 149 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 150 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 151 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 152 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 153 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 154 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 155 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 156 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 157 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 158 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 159 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 160 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 161 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 162 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 163 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 164 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 165 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 166 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 167 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 168 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 169 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 170 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 171 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 172 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 173 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 174 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 175 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 176 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 177 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 178 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 179 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 180 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 181 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 182 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 183 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 184 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 185 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 186 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 187 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 188 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 189 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 190 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 191 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 192 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 193 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 194 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 195 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 196 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 197 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 198 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 199 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 200 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 201 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 202 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 203 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 204 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 205 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 206 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 207 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 208 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 209 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 210 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 211 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 212 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 213 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 214 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 215 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 216 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 217 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 218 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 219 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 220 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 221 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 222 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 223 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 224 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 225 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 226 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 227 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 228 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 229 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 230 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 231 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 232 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 233 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 234 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 235 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 236 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 237 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 238 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 239 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 240 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 241 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 242 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 243 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 244 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 245 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 246 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 247 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 248 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 249 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 250 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 251 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 252 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 253 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 254 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 255 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 256 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 257 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 258 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 259 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 260 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 261 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 262 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 263 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 264 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 265 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 266 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 267 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 268 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 269 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 270 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 271 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 272 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 273 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 274 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 275 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 276 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 277 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 278 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 279 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 280 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 281 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 282 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 283 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 284 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 285 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 286 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 287 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 288 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 289 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 290 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 291 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 292 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 293 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 294 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 295 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 296 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 297 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 298 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 299 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 300 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 301 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 302 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 303 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 304 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 305 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 306 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 307 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 308 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 309 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 310 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 311 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 312 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 313 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 314 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 315 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 316 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 317 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 318 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 319 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 320 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 321 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 322 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 323 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 324 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 325 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 326 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 327 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 328 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 329 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 330 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 331 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 332 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 333 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 334 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 335 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 336 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 337 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 338 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 339 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 340 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 341 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 342 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 343 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 344 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 345 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 346 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 347 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 348 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 349 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 350 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 351 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 352 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 353 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 354 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 355 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 356 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 357 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 358 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 359 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 360 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 361 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 362 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 363 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 364 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 365 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 366 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 367 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 368 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 369 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 370 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 371 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 372 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 373 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 374 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 375 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 376 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 377 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 378 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 379 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 380 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 381 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 382 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 383 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 384 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 385 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 386 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 387 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 388 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 389 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 390 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 391 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 392 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 393 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 394 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 395 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 396 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 397 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 398 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 399 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 400 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 401 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 402 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 403 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 404 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 405 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 406 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 407 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 408 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 409 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 410 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 411 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 412 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 413 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 414 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 415 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 416 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 417 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 418 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 419 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 420 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 421 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 422 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 423 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok # You named your test '71'. You shouldn't use numbers for your test names. # Very confusing. # You named your test '91'. You shouldn't use numbers for your test names. # Very confusing. t/Coil.t ...................... 1..6 ok 1 - use Bio::Tools::Run::Coil; ok 2 - use Bio::SeqIO; ok 3 ok 4 ok 5 - 71 ok 6 - 91 ok # Required executable for Bio::Tools::Run::Phylo::Phylip::Consense is not present t/Consense.t .................. 1..8 ok 1 - use Bio::Tools::Run::Phylo::Phylip::Consense; ok 2 - use Bio::AlignIO; ok 3 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Consense is not present ok 4 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Consense is not present ok 5 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Consense is not present ok 6 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Consense is not present ok 7 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Consense is not present ok 8 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Consense is not present ok Warning Error Strangely truncated line in fasta file Warning Error Strangely truncated line in fasta file Find start end points: 1000 Cells done [ 2%] 2000 Cells done [ 4%] 3000 Cells done [ 6%] 4000 Cells done [ 8%] 5000 Cells done [10%] 6000 Cells done [12%] 7000 Cells done [14%] 8000 Cells done [16%] 9000 Cells done [19%] 10000 Cells done [21%] 11000 Cells done [23%] 12000 Cells done [25%] 13000 Cells done [27%] 14000 Cells done [29%] 15000 Cells done [31%] 16000 Cells done [33%] 17000 Cells done [35%] 18000 Cells done [38%] 19000 Cells done [40%] 20000 Cells done [42%] 21000 Cells done [44%] 22000 Cells done [46%] 23000 Cells done [48%] 24000 Cells done [50%] 25000 Cells done [52%] 26000 Cells done [55%] 27000 Cells done [57%] 28000 Cells done [59%] 29000 Cells done [61%] 30000 Cells done [63%] 31000 Cells done [65%] 32000 Cells done [67%] 33000 Cells done [69%] 34000 Cells done [71%] 35000 Cells done [74%] 36000 Cells done [76%] 37000 Cells done [78%] 38000 Cells done [80%] 39000 Cells done [82%] 40000 Cells done [84%] 41000 Cells done [86%] 42000 Cells done [88%] 43000 Cells done [90%] 44000 Cells done [93%] 45000 Cells done [95%] 46000 Cells done [97%] 47000 Cells done [99%][0,0][0,0] Score 0 Recovering alignment: [0,0][0,0] Explicit read offWarning Error Major problem (!) - in DnaMatchBlock read off, position 0,0 state 0 no source found! Warning Error In DnaMatchBlock hidden read off, between 0:0,0:0 - at got bad read off. Problem! Warning Error In full dc, at 0:0,0:0 got a bad hidden explicit read off... Warning Error Major problem (!) - in DnaMatchBlock matrix to special read off, position 0,0 state 0 no source found! Warning Error Problem in reading off special state system, hit a non start state (or an internal error) in a single alignment mode Warning Error Strangely truncated line in fasta file Warning Error Strangely truncated line in fasta file Find start end points: 1000 Cells done [ 2%] 2000 Cells done [ 4%] 3000 Cells done [ 7%] 4000 Cells done [ 9%] 5000 Cells done [12%] 6000 Cells done [14%] 7000 Cells done [16%] 8000 Cells done [19%] 9000 Cells done [21%] 10000 Cells done [24%] 11000 Cells done [26%] 12000 Cells done [28%] 13000 Cells done [31%] 14000 Cells done [33%] 15000 Cells done [36%] 16000 Cells done [38%] 17000 Cells done [40%] 18000 Cells done [43%] 19000 Cells done [45%] 20000 Cells done [48%] 21000 Cells done [50%] 22000 Cells done [52%] 23000 Cells done [55%] 24000 Cells done [57%] 25000 Cells done [60%] 26000 Cells done [62%] 27000 Cells done [64%] 28000 Cells done [67%] 29000 Cells done [69%] 30000 Cells done [72%] 31000 Cells done [74%] 32000 Cells done [76%] 33000 Cells done [79%] 34000 Cells done [81%] 35000 Cells done [84%] 36000 Cells done [86%] 37000 Cells done [89%] 38000 Cells done [91%] 39000 Cells done [93%] 40000 Cells done [96%] 41000 Cells done [98%][0,0][0,0] Score 0 Recovering alignment: [0,0][0,0] Explicit read offWarning Error Major problem (!) - in DnaMatchBlock read off, position 0,0 state 0 no source found! Warning Error In DnaMatchBlock hidden read off, between 0:0,0:0 - at got bad read off. Problem! Warning Error In full dc, at 0:0,0:0 got a bad hidden explicit read off... Warning Error Major problem (!) - in DnaMatchBlock matrix to special read off, position 0,0 state 0 no source found! Warning Error Problem in reading off special state system, hit a non start state (or an internal error) in a single alignment mode Warning Error Strangely truncated line in fasta file Warning Error Strangely truncated line in fasta file Find start end points: 1000 Cells done [ 2%] 2000 Cells done [ 4%] 3000 Cells done [ 6%] 4000 Cells done [ 8%] 5000 Cells done [10%] 6000 Cells done [12%] 7000 Cells done [14%] 8000 Cells done [16%] 9000 Cells done [19%] 10000 Cells done [21%] 11000 Cells done [23%] 12000 Cells done [25%] 13000 Cells done [27%] 14000 Cells done [29%] 15000 Cells done [31%] 16000 Cells done [33%] 17000 Cells done [35%] 18000 Cells done [38%] 19000 Cells done [40%] 20000 Cells done [42%] 21000 Cells done [44%] 22000 Cells done [46%] 23000 Cells done [48%] 24000 Cells done [50%] 25000 Cells done [52%] 26000 Cells done [55%] 27000 Cells done [57%] 28000 Cells done [59%] 29000 Cells done [61%] 30000 Cells done [63%] 31000 Cells done [65%] 32000 Cells done [67%] 33000 Cells done [69%] 34000 Cells done [71%] 35000 Cells done [74%] 36000 Cells done [76%] 37000 Cells done [78%] 38000 Cells done [80%] 39000 Cells done [82%] 40000 Cells done [84%] 41000 Cells done [86%] 42000 Cells done [88%] 43000 Cells done [90%] 44000 Cells done [93%] 45000 Cells done [95%] 46000 Cells done [97%] 47000 Cells done [99%][0,0][0,0] Score 0 Recovering alignment: [0,0][0,0] Explicit read offWarning Error Major problem (!) - in DnaMatchBlock read off, position 0,0 state 0 no source found! Warning Error In DnaMatchBlock hidden read off, between 0:0,0:0 - at got bad read off. Problem! Warning Error In full dc, at 0:0,0:0 got a bad hidden explicit read off... Warning Error Major problem (!) - in DnaMatchBlock matrix to special read off, position 0,0 state 0 no source found! Warning Error Problem in reading off special state system, hit a non start state (or an internal error) in a single alignment mode t/DBA.t ....................... 1..5 ok 1 - use Bio::Tools::Run::Alignment::DBA; ok 2 - use Bio::SimpleAlign; ok 3 - use Bio::AlignIO; ok 4 - use Bio::SeqIO; ok 5 - An object of class 'Bio::Tools::Run::Alignment::DBA' isa 'Bio::Tools::Run::Alignment::DBA' ok # Required executable for Bio::Tools::Run::Phylo::Phylip::DrawGram is not present t/DrawGram.t .................. 1..6 ok 1 - use Bio::Tools::Run::Phylo::Phylip::DrawGram; ok 2 - use Bio::TreeIO; ok 3 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::DrawGram is not present ok 4 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::DrawGram is not present ok 5 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::DrawGram is not present ok 6 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::DrawGram is not present ok # Required executable for Bio::Tools::Run::Phylo::Phylip::DrawTree is not present t/DrawTree.t .................. 1..6 ok 1 - use Bio::Tools::Run::Phylo::Phylip::DrawTree; ok 2 - use Bio::TreeIO; ok 3 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::DrawTree is not present ok 4 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::DrawTree is not present ok 5 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::DrawTree is not present ok 6 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::DrawTree is not present ok t/EMBOSS.t .................... 1..31 ok 1 - use Bio::Root::IO; ok 2 - use Bio::SeqIO; ok 3 - use Bio::AlignIO; ok 4 - use Bio::Factory::EMBOSS; ok 5 ok 6 # skip EMBOSS not installed ok 7 # skip EMBOSS not installed ok 8 # skip EMBOSS not installed ok 9 # skip EMBOSS not installed ok 10 # skip EMBOSS not installed ok 11 # skip EMBOSS not installed ok 12 # skip EMBOSS not installed ok 13 # skip EMBOSS not installed ok 14 # skip EMBOSS not installed ok 15 # skip EMBOSS not installed ok 16 # skip EMBOSS not installed ok 17 # skip EMBOSS not installed ok 18 # skip EMBOSS not installed ok 19 # skip EMBOSS not installed ok 20 # skip EMBOSS not installed ok 21 # skip EMBOSS not installed ok 22 # skip EMBOSS not installed ok 23 # skip EMBOSS not installed ok 24 # skip EMBOSS not installed ok 25 # skip EMBOSS not installed ok 26 # skip EMBOSS not installed ok 27 # skip EMBOSS not installed ok 28 # skip EMBOSS not installed ok 29 # skip EMBOSS not installed ok 30 # skip EMBOSS not installed ok 31 # skip EMBOSS not installed ok t/Exonerate.t ................. 1..89 ok 1 - use Bio::Tools::Run::Alignment::Exonerate; ok 2 - An object of class 'Bio::Tools::Run::Alignment::Exonerate' isa 'Bio::Tools::Run::Alignment::Exonerate' ok 3 ok 4 - An object of class 'Bio::SearchIO::exonerate' isa 'Bio::SearchIO' ok 5 ok 6 ok 7 ok 8 ok 9 ok 10 ok 11 ok 12 ok 13 ok 14 ok 15 ok 16 ok 17 ok 18 ok 19 ok 20 ok 21 ok 22 ok 23 ok 24 ok 25 ok 26 ok 27 ok 28 ok 29 ok 30 ok 31 ok 32 ok 33 ok 34 ok 35 ok 36 ok 37 ok 38 ok 39 ok 40 ok 41 ok 42 ok 43 ok 44 ok 45 ok 46 ok 47 - An object of class 'Bio::SearchIO::exonerate' isa 'Bio::SearchIO' ok 48 ok 49 ok 50 ok 51 ok 52 ok 53 ok 54 ok 55 ok 56 ok 57 ok 58 ok 59 ok 60 ok 61 ok 62 ok 63 ok 64 ok 65 ok 66 ok 67 ok 68 ok 69 ok 70 ok 71 ok 72 ok 73 ok 74 ok 75 ok 76 ok 77 ok 78 ok 79 ok 80 ok 81 ok 82 ok 83 ok 84 ok 85 ok 86 ok 87 ok 88 ok 89 ok t/FastTree.t .................. 1..9 ok 1 - use Bio::Root::IO; ok 2 - use Bio::Tools::Run::Phylo::FastTree; ok 3 - use Bio::AlignIO; ok 4 - Make the object ok 5 - Tree is defined ok 6 - Number of nodes is correct ok 7 - Tree is defined ok 8 - Tree is defined ok 9 - Tree is defined ok # Required executable for Bio::Tools::Run::FootPrinter is not present t/FootPrinter.t ............... 1..24 ok 1 - use Bio::Tools::Run::FootPrinter; ok 2 - use Bio::SeqIO; ok 3 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 4 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 5 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 6 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 7 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 8 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 9 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 10 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 11 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 12 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 13 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 14 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 15 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 16 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 17 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 18 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 19 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 20 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 21 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 22 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 23 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 24 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok # Required environment variable $GENEMARK_MODELS is not set t/Genemark.hmm.prokaryotic.t .. 1..99 ok 1 - use Bio::Tools::Run::Genemark; ok 2 - use Bio::Root::IO; ok 3 - use Bio::Seq; ok 4 # skip Required environment variable $GENEMARK_MODELS is not set ok 5 # skip Required environment variable $GENEMARK_MODELS is not set ok 6 # skip Required environment variable $GENEMARK_MODELS is not set ok 7 # skip Required environment variable $GENEMARK_MODELS is not set ok 8 # skip Required environment variable $GENEMARK_MODELS is not set ok 9 # skip Required environment variable $GENEMARK_MODELS is not set ok 10 # skip Required environment variable $GENEMARK_MODELS is not set ok 11 # skip Required environment variable $GENEMARK_MODELS is not set ok 12 # skip Required environment variable $GENEMARK_MODELS is not set ok 13 # skip Required environment variable $GENEMARK_MODELS is not set ok 14 # skip Required environment variable $GENEMARK_MODELS is not set ok 15 # skip Required environment variable $GENEMARK_MODELS is not set ok 16 # skip Required environment variable $GENEMARK_MODELS is not set ok 17 # skip Required environment variable $GENEMARK_MODELS is not set ok 18 # skip Required environment variable $GENEMARK_MODELS is not set ok 19 # skip Required environment variable $GENEMARK_MODELS is not set ok 20 # skip Required environment variable $GENEMARK_MODELS is not set ok 21 # skip Required environment variable $GENEMARK_MODELS is not set ok 22 # skip Required environment variable $GENEMARK_MODELS is not set ok 23 # skip Required environment variable $GENEMARK_MODELS is not set ok 24 # skip Required environment variable $GENEMARK_MODELS is not set ok 25 # skip Required environment variable $GENEMARK_MODELS is not set ok 26 # skip Required environment variable $GENEMARK_MODELS is not set ok 27 # skip Required environment variable $GENEMARK_MODELS is not set ok 28 # skip Required environment variable $GENEMARK_MODELS is not set ok 29 # skip Required environment variable $GENEMARK_MODELS is not set ok 30 # skip Required environment variable $GENEMARK_MODELS is not set ok 31 # skip Required environment variable $GENEMARK_MODELS is not set ok 32 # skip Required environment variable $GENEMARK_MODELS is not set ok 33 # skip Required environment variable $GENEMARK_MODELS is not set ok 34 # skip Required environment variable $GENEMARK_MODELS is not set ok 35 # skip Required environment variable $GENEMARK_MODELS is not set ok 36 # skip Required environment variable $GENEMARK_MODELS is not set ok 37 # skip Required environment variable $GENEMARK_MODELS is not set ok 38 # skip Required environment variable $GENEMARK_MODELS is not set ok 39 # skip Required environment variable $GENEMARK_MODELS is not set ok 40 # skip Required environment variable $GENEMARK_MODELS is not set ok 41 # skip Required environment variable $GENEMARK_MODELS is not set ok 42 # skip Required environment variable $GENEMARK_MODELS is not set ok 43 # skip Required environment variable $GENEMARK_MODELS is not set ok 44 # skip Required environment variable $GENEMARK_MODELS is not set ok 45 # skip Required environment variable $GENEMARK_MODELS is not set ok 46 # skip Required environment variable $GENEMARK_MODELS is not set ok 47 # skip Required environment variable $GENEMARK_MODELS is not set ok 48 # skip Required environment variable $GENEMARK_MODELS is not set ok 49 # skip Required environment variable $GENEMARK_MODELS is not set ok 50 # skip Required environment variable $GENEMARK_MODELS is not set ok 51 # skip Required environment variable $GENEMARK_MODELS is not set ok 52 # skip Required environment variable $GENEMARK_MODELS is not set ok 53 # skip Required environment variable $GENEMARK_MODELS is not set ok 54 # skip Required environment variable $GENEMARK_MODELS is not set ok 55 # skip Required environment variable $GENEMARK_MODELS is not set ok 56 # skip Required environment variable $GENEMARK_MODELS is not set ok 57 # skip Required environment variable $GENEMARK_MODELS is not set ok 58 # skip Required environment variable $GENEMARK_MODELS is not set ok 59 # skip Required environment variable $GENEMARK_MODELS is not set ok 60 # skip Required environment variable $GENEMARK_MODELS is not set ok 61 # skip Required environment variable $GENEMARK_MODELS is not set ok 62 # skip Required environment variable $GENEMARK_MODELS is not set ok 63 # skip Required environment variable $GENEMARK_MODELS is not set ok 64 # skip Required environment variable $GENEMARK_MODELS is not set ok 65 # skip Required environment variable $GENEMARK_MODELS is not set ok 66 # skip Required environment variable $GENEMARK_MODELS is not set ok 67 # skip Required environment variable $GENEMARK_MODELS is not set ok 68 # skip Required environment variable $GENEMARK_MODELS is not set ok 69 # skip Required environment variable $GENEMARK_MODELS is not set ok 70 # skip Required environment variable $GENEMARK_MODELS is not set ok 71 # skip Required environment variable $GENEMARK_MODELS is not set ok 72 # skip Required environment variable $GENEMARK_MODELS is not set ok 73 # skip Required environment variable $GENEMARK_MODELS is not set ok 74 # skip Required environment variable $GENEMARK_MODELS is not set ok 75 # skip Required environment variable $GENEMARK_MODELS is not set ok 76 # skip Required environment variable $GENEMARK_MODELS is not set ok 77 # skip Required environment variable $GENEMARK_MODELS is not set ok 78 # skip Required environment variable $GENEMARK_MODELS is not set ok 79 # skip Required environment variable $GENEMARK_MODELS is not set ok 80 # skip Required environment variable $GENEMARK_MODELS is not set ok 81 # skip Required environment variable $GENEMARK_MODELS is not set ok 82 # skip Required environment variable $GENEMARK_MODELS is not set ok 83 # skip Required environment variable $GENEMARK_MODELS is not set ok 84 # skip Required environment variable $GENEMARK_MODELS is not set ok 85 # skip Required environment variable $GENEMARK_MODELS is not set ok 86 # skip Required environment variable $GENEMARK_MODELS is not set ok 87 # skip Required environment variable $GENEMARK_MODELS is not set ok 88 # skip Required environment variable $GENEMARK_MODELS is not set ok 89 # skip Required environment variable $GENEMARK_MODELS is not set ok 90 # skip Required environment variable $GENEMARK_MODELS is not set ok 91 # skip Required environment variable $GENEMARK_MODELS is not set ok 92 # skip Required environment variable $GENEMARK_MODELS is not set ok 93 # skip Required environment variable $GENEMARK_MODELS is not set ok 94 # skip Required environment variable $GENEMARK_MODELS is not set ok 95 # skip Required environment variable $GENEMARK_MODELS is not set ok 96 # skip Required environment variable $GENEMARK_MODELS is not set ok 97 # skip Required environment variable $GENEMARK_MODELS is not set ok 98 # skip Required environment variable $GENEMARK_MODELS is not set ok 99 # skip Required environment variable $GENEMARK_MODELS is not set ok These tests may fail because I'm not sure about your genewise version -- using wise 2.2.3-rc7 values t/Genewise.t .................. 1..17 ok 1 - use Bio::Tools::Run::Genewise; ok 2 - use Bio::Root::IO; ok 3 - use Bio::Seq; ok 4 - An object of class 'Bio::Tools::Run::Genewise' isa 'Bio::Tools::Run::Genewise' ok 5 ok 6 ok 7 ok 8 ok 9 ok 10 ok 11 ok 12 ok 13 ok 14 ok 15 ok 16 ok 17 ok # Required environment variable $GENSCANDIR is not set t/Genscan.t ................... 1..6 ok 1 - use Bio::Tools::Run::Genscan; ok 2 - use Bio::Root::IO; ok 3 # skip Required environment variable $GENSCANDIR is not set ok 4 # skip Required environment variable $GENSCANDIR is not set ok 5 # skip Required environment variable $GENSCANDIR is not set ok 6 # skip Required environment variable $GENSCANDIR is not set ok # Required executable for Bio::Tools::Run::Phylo::Gerp is not present t/Gerp.t ...................... 1..33 ok 1 - use Bio::Tools::Run::Phylo::Gerp; ok 2 - use Bio::AlignIO; ok 3 - use Bio::TreeIO; ok 4 - use Bio::Root::Utilities; ok 5 - Found input alignment file ok 6 - Found input tree file ok 7 - An object of class 'Bio::Tools::Run::Phylo::Gerp' isa 'Bio::Tools::Run::Phylo::Gerp' ok 8 - has a created method not in args supplied to new ok 9 - quiet was set ok 10 - program_dir returned correct default ok 11 - Correct exe default name ok 12 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 13 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 14 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 15 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 16 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 17 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 18 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 19 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 20 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 21 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 22 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 23 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 24 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 25 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 26 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 27 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 28 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 29 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 30 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 31 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 32 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 33 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok # Required executable for Bio::Tools::Run::Glimmer is not present t/Glimmer3.t .................. 1..111 ok 1 - use Bio::Tools::Run::Glimmer; ok 2 - use Bio::Root::IO; ok 3 - use Bio::Seq; ok 4 - An object of class 'Bio::Tools::Run::Glimmer' isa 'Bio::Tools::Run::Glimmer' ok 5 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 6 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 7 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 8 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 9 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 10 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 11 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 12 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 13 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 14 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 15 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 16 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 17 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 18 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 19 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 20 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 21 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 22 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 23 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 24 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 25 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 26 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 27 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 28 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 29 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 30 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 31 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 32 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 33 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 34 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 35 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 36 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 37 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 38 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 39 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 40 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 41 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 42 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 43 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 44 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 45 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 46 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 47 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 48 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 49 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 50 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 51 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 52 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 53 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 54 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 55 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 56 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 57 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 58 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 59 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 60 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 61 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 62 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 63 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 64 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 65 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 66 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 67 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 68 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 69 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 70 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 71 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 72 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 73 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 74 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 75 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 76 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 77 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 78 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 79 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 80 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 81 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 82 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 83 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 84 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 85 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 86 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 87 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 88 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 89 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 90 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 91 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 92 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 93 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 94 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 95 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 96 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 97 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 98 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 99 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 100 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 101 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 102 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 103 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 104 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 105 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 106 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 107 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 108 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 109 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 110 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 111 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok # Required executable for Bio::Tools::Run::Hmmer is not present t/Hmmer.t ..................... 1..27 ok 1 - use Bio::Tools::Run::Hmmer; ok 2 - use Bio::SeqIO; ok 3 - use Bio::AlignIO; ok 4 - An object of class 'Bio::Tools::Run::Hmmer' isa 'Bio::Tools::Run::Hmmer' ok 5 ok 6 ok 7 ok 8 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 9 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 10 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 11 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 12 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 13 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 14 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 15 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 16 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 17 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 18 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 19 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 20 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 21 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 22 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 23 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 24 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 25 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 26 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 27 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok t/Infernal.t .................. 1..3 ok 1 - use Bio::Tools::Run::Infernal; ok 2 - use Bio::SeqIO; ok 3 - use Bio::AlignIO; ok t/Kalign.t .................... 1..7 ok 1 - use Bio::Tools::Run::Alignment::Kalign; ok 2 - use Bio::AlignIO; ok 3 - use Bio::SeqIO; ok 4 - Code tested only on kalign versions >= 2 Kalign (3.4.0) Copyright (C) 2006,2019,2020,2021,2023 Timo Lassmann This program comes with ABSOLUTELY NO WARRANTY; for details type: `kalign -showw'. This is free software, and you are welcome to redistribute it under certain conditions; consult the COPYING file for details. Please cite: Lassmann, Timo. "Kalign 3: multiple sequence alignment of large data sets." Bioinformatics (2019) https://doi.org/10.1093/bioinformatics/btz795 [2024-04-28 20:29:26] : LOG : Detected protein sequences. [2024-04-28 20:29:26] : LOG : Read 7 sequences from standard input. [2024-04-28 20:29:26] : LOG : CPU Time: 0.00u 00:00:00.00 Elapsed: 00:00:00.00 [2024-04-28 20:29:26] : LOG : Calculating pairwise distances [2024-04-28 20:29:26] : LOG : CPU Time: 0.01u 00:00:00.00 Elapsed: 00:00:00.00 [2024-04-28 20:29:26] : LOG : Building guide tree. [2024-04-28 20:29:26] : LOG : CPU Time: 0.01u 00:00:00.00 Elapsed: 00:00:00.00 [2024-04-28 20:29:26] : LOG : Aligning [2024-04-28 20:29:26] : LOG : CPU Time: 0.06u 00:00:00.06 Elapsed: 00:00:00.00 ok 5 ok 6 Kalign (3.4.0) Copyright (C) 2006,2019,2020,2021,2023 Timo Lassmann This program comes with ABSOLUTELY NO WARRANTY; for details type: `kalign -showw'. This is free software, and you are welcome to redistribute it under certain conditions; consult the COPYING file for details. Please cite: Lassmann, Timo. "Kalign 3: multiple sequence alignment of large data sets." Bioinformatics (2019) https://doi.org/10.1093/bioinformatics/btz795 [2024-04-28 20:29:26] : LOG : Detected protein sequences. [2024-04-28 20:29:26] : LOG : Read 7 sequences from standard input. [2024-04-28 20:29:26] : LOG : CPU Time: 0.00u 00:00:00.00 Elapsed: 00:00:00.00 [2024-04-28 20:29:26] : LOG : Calculating pairwise distances [2024-04-28 20:29:26] : LOG : CPU Time: 0.01u 00:00:00.00 Elapsed: 00:00:00.00 [2024-04-28 20:29:26] : LOG : Building guide tree. [2024-04-28 20:29:26] : LOG : CPU Time: 0.01u 00:00:00.00 Elapsed: 00:00:00.00 [2024-04-28 20:29:26] : LOG : Aligning [2024-04-28 20:29:26] : LOG : CPU Time: 0.07u 00:00:00.06 Elapsed: 00:00:00.00 ok 7 ok # Required executable for Bio::Tools::Run::Phylo::LVB is not present t/LVB.t ....................... 1..19 ok 1 - use Bio::Tools::Run::Phylo::LVB; ok 2 - use Bio::AlignIO; ok 3 - An object of class 'Bio::Tools::Run::Phylo::LVB' isa 'Bio::Tools::Run::Phylo::LVB' ok 4 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 5 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 6 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 7 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 8 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 9 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 10 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 11 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 12 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 13 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 14 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 15 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 16 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 17 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 18 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 19 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok # Required executable for Bio::Tools::Run::Alignment::Lagan is not present t/Lagan.t ..................... 1..12 ok 1 - use Bio::AlignIO; ok 2 - use Bio::Tools::Run::Alignment::Lagan; ok 3 - use Bio::Root::IO; ok 4 - use Bio::SeqIO; ok 5 - use Bio::Seq; ok 6 - use Bio::Matrix::Mlagan; ok 7 - An object of class 'Bio::Tools::Run::Alignment::Lagan' isa 'Bio::Tools::Run::Alignment::Lagan' ok 8 # skip Required executable for Bio::Tools::Run::Alignment::Lagan is not present ok 9 # skip Required executable for Bio::Tools::Run::Alignment::Lagan is not present ok 10 # skip Required executable for Bio::Tools::Run::Alignment::Lagan is not present ok 11 # skip Required executable for Bio::Tools::Run::Alignment::Lagan is not present ok 12 # skip Required executable for Bio::Tools::Run::Alignment::Lagan is not present ok t/MAFFT.t ..................... 1..23 ok 1 - use Bio::Tools::Run::Alignment::MAFFT; ok 2 - use Bio::AlignIO; ok 3 - use Bio::SeqIO; ok 4 - An object of class 'Bio::Tools::Run::Alignment::MAFFT' isa 'Bio::Tools::Run::Alignment::MAFFT' ok 5 ok 6 ok 7 ok 8 ok 9 - 42 or 43 expected ok 10 ok 11 ok 12 ok 13 ok 14 ok 15 ok 16 ok 17 ok 18 # skip Tests require version 6 of MAFFT ok 19 # skip Tests require version 6 of MAFFT ok 20 # skip Tests require version 6 of MAFFT ok 21 # skip Tests require version 6 of MAFFT ok 22 # skip Tests require version 6 of MAFFT ok 23 # skip Tests require version 6 of MAFFT ok # Required executable for Bio::Tools::Run::Alignment::MSAProbs is not present t/MSAProbs.t .................. 1..19 ok 1 - use Bio::Tools::Run::Alignment::MSAProbs; ok 2 - use Bio::Tools::GuessSeqFormat; ok 3 - use Bio::AlignIO; ok 4 - use Bio::SeqIO; ok 5 - use Bio::Root::IO; ok 6 - use POSIX; ok 7 ok 8 # skip Required executable for Bio::Tools::Run::Alignment::MSAProbs is not present ok 9 # skip Required executable for Bio::Tools::Run::Alignment::MSAProbs is not present ok 10 # skip Required executable for Bio::Tools::Run::Alignment::MSAProbs is not present ok 11 # skip Required executable for Bio::Tools::Run::Alignment::MSAProbs is not present ok 12 # skip Required executable for Bio::Tools::Run::Alignment::MSAProbs is not present ok 13 # skip Required executable for Bio::Tools::Run::Alignment::MSAProbs is not present ok 14 # skip Required executable for Bio::Tools::Run::Alignment::MSAProbs is not present ok 15 # skip Required executable for Bio::Tools::Run::Alignment::MSAProbs is not present ok 16 # skip Required executable for Bio::Tools::Run::Alignment::MSAProbs is not present ok 17 # skip Required executable for Bio::Tools::Run::Alignment::MSAProbs is not present ok 18 # skip Required executable for Bio::Tools::Run::Alignment::MSAProbs is not present ok 19 # skip Required executable for Bio::Tools::Run::Alignment::MSAProbs is not present ok # Required executable for Bio::Tools::Run::Match is not present t/Match.t ..................... 1..7 ok 1 - use Bio::Tools::Run::Match; ok 2 - An object of class 'Bio::Tools::Run::Match' isa 'Bio::Tools::Run::Match' ok 3 - mxlib parameter was set ok 4 - program_dir returned correct default ok 5 - Correct exe default name ok 6 # skip Required executable for Bio::Tools::Run::Match is not present ok 7 # skip Required executable for Bio::Tools::Run::Match is not present ok # Required executable for Bio::Tools::Run::Mdust is not present t/Mdust.t ..................... 1..5 ok 1 - use Bio::Tools::Run::Mdust; ok 2 - use Bio::SeqIO; ok 3 - An object of class 'Bio::Tools::Run::Mdust' isa 'Bio::Tools::Run::Mdust' ok 4 # skip Required executable for Bio::Tools::Run::Mdust is not present ok 5 # skip Required executable for Bio::Tools::Run::Mdust is not present ok # Required executable for Bio::Tools::Run::Phylo::Molphy::ProtML is not present t/Molphy.t .................... 1..10 ok 1 - use Bio::Tools::Phylo::Molphy; ok 2 - use Bio::Tools::Run::Phylo::Molphy::ProtML; ok 3 - use Bio::AlignIO; ok 4 # skip Required executable for Bio::Tools::Run::Phylo::Molphy::ProtML is not present ok 5 # skip Required executable for Bio::Tools::Run::Phylo::Molphy::ProtML is not present ok 6 # skip Required executable for Bio::Tools::Run::Phylo::Molphy::ProtML is not present ok 7 # skip Required executable for Bio::Tools::Run::Phylo::Molphy::ProtML is not present ok 8 # skip Required executable for Bio::Tools::Run::Phylo::Molphy::ProtML is not present ok 9 # skip Required executable for Bio::Tools::Run::Phylo::Molphy::ProtML is not present ok 10 # skip Required executable for Bio::Tools::Run::Phylo::Molphy::ProtML is not present ok t/Muscle.t .................... 1..16 ok 1 - use Bio::Tools::Run::Alignment::Muscle; ok 2 - use Bio::AlignIO; ok 3 - use Bio::SeqIO; ok 4 - use Bio::Root::IO; ok 5 - use POSIX; ok 6 ok 7 # skip Only muscle version 3.6 or higher is supported by these tests. Skipping tests ok 8 # skip Only muscle version 3.6 or higher is supported by these tests. Skipping tests ok 9 # skip Only muscle version 3.6 or higher is supported by these tests. Skipping tests ok 10 # skip Only muscle version 3.6 or higher is supported by these tests. Skipping tests ok 11 # skip Only muscle version 3.6 or higher is supported by these tests. Skipping tests ok 12 # skip Only muscle version 3.6 or higher is supported by these tests. Skipping tests ok 13 # skip Only muscle version 3.6 or higher is supported by these tests. Skipping tests ok 14 # skip Only muscle version 3.6 or higher is supported by these tests. Skipping tests ok 15 # skip Only muscle version 3.6 or higher is supported by these tests. Skipping tests ok 16 # skip Only muscle version 3.6 or higher is supported by these tests. Skipping tests ok # Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present t/Neighbor.t .................. 1..19 ok 1 - use Bio::Tools::Run::Phylo::Phylip::ProtDist; ok 2 - use Bio::Tools::Run::Phylo::Phylip::Neighbor; ok 3 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 4 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 5 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 6 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 7 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 8 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 9 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 10 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 11 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 12 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 13 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 14 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 15 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 16 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 17 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 18 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 19 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok # Required executable for Bio::Tools::Run::Phylo::Njtree::Best is not present t/Njtree.t .................... 1..6 ok 1 - use Bio::Root::IO; ok 2 - use Bio::Tools::Run::Phylo::Njtree::Best; ok 3 - use Bio::AlignIO; ok 4 - use Bio::TreeIO; ok 5 ok 6 # skip Required executable for Bio::Tools::Run::Phylo::Njtree::Best is not present ok --------------------- WARNING --------------------- MSG: In sequence pseudogene residue count gives end value 183. Overriding value [178] with value 183 for Bio::LocatableSeq::end(). ----LNCIVNDSQKMGIIRNGDLP*PQLKNKF2-FQRMTTPSSAEGKENLVFLIRKNWFSITEKNQPLKYIINLVVSRESKEPPQRPPFLD*SLGDALKRIEQLKLANKQDVFFTVGGSSVYKESMN*-DHFKLFVTWIMQDFQSDTFFS4EGDLEKYKLLPEYPQGVVSDVEEEKGIKYKFEVYEKND --------------------------------------------------- --------------------- WARNING --------------------- MSG: In sequence pseudogene residue count gives end value 183. Overriding value [178] with value 183 for Bio::LocatableSeq::end(). ----LNCIVNDSQKMGIIRNGDLP*PQLKNKF2-FQRMTTPSSAEGKENLVFLIRKNWFSITEKNQPLKYIINLVVSRESKEPPQRPPFLD*SLGDALKRIEQLKLANKQDVFFTVGGSSVYKESMN*-DHFKLFVTWIMQDFQSDTFFS4EGDLEKYKLLPEYPQGVVSDVEEEKGIKYKFEVYEKND --------------------------------------------------- t/Pal2Nal.t ................... 1..9 ok 1 - use Bio::Tools::Run::Alignment::Pal2Nal; ok 2 - An object of class 'Bio::Tools::Run::Alignment::Pal2Nal' isa 'Bio::Tools::Run::Alignment::Pal2Nal' ok 3 - program_dir returned correct default ok 4 - Correct exe default name ok 5 ok 6 - use Bio::AlignIO; ok 7 - use Bio::SeqIO; ok 8 ok 9 ok # Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present t/PhastCons.t ................. 1..181 ok 1 - use Bio::AlignIO; ok 2 - use Bio::TreeIO; ok 3 - use Bio::DB::Taxonomy; ok 4 - Found input alignment file ok 5 - Found input tree file ok 6 - use Bio::Tools::Run::Phylo::Phast::PhastCons; ok 7 - An object of class 'Bio::Tools::Run::Phylo::Phast::PhastCons' isa 'Bio::Tools::Run::Phylo::Phast::PhastCons' ok 8 - has a created method not in args ok 9 - dashed parameter with internal dash was set ok 10 - wrong-case method wasn't created ok 11 - dashless wrong-case parameter was set ok 12 - synonym installed and accessed primary value ok 13 - double-dashed parameter was set ok 14 - program_dir returned correct default ok 15 - Correct exe default name ok 16 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 17 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 18 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 19 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 20 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 21 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 22 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 23 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 24 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 25 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 26 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 27 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 28 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 29 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 30 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 31 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 32 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 33 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 34 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 35 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 36 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 37 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 38 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 39 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 40 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 41 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 42 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 43 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 44 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 45 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 46 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 47 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 48 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 49 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 50 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 51 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 52 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 53 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 54 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 55 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 56 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 57 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 58 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 59 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 60 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 61 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 62 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 63 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 64 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 65 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 66 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 67 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 68 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 69 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 70 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 71 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 72 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 73 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 74 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 75 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 76 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 77 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 78 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 79 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 80 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 81 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 82 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 83 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 84 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 85 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 86 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 87 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 88 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 89 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 90 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 91 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 92 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 93 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 94 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 95 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 96 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 97 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 98 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 99 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 100 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 101 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 102 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 103 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 104 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 105 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 106 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 107 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 108 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 109 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 110 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 111 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 112 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 113 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 114 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 115 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 116 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 117 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 118 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 119 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 120 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 121 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 122 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 123 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 124 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 125 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 126 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 127 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 128 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 129 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 130 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 131 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 132 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 133 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 134 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 135 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 136 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 137 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 138 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 139 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 140 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 141 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 142 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 143 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 144 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 145 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 146 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 147 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 148 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 149 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 150 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 151 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 152 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 153 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 154 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 155 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 156 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 157 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 158 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 159 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 160 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 161 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 162 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 163 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 164 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 165 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 166 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 167 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 168 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 169 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 170 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 171 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 172 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 173 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 174 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 175 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 176 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 177 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 178 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 179 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 180 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 181 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok # Required executable for Bio::Tools::Run::Primate is not present t/Primate.t ................... 1..8 ok 1 - use Bio::Tools::Run::Primate; ok 2 - use Bio::SeqIO; ok 3 # skip Required executable for Bio::Tools::Run::Primate is not present ok 4 # skip Required executable for Bio::Tools::Run::Primate is not present ok 5 # skip Required executable for Bio::Tools::Run::Primate is not present ok 6 # skip Required executable for Bio::Tools::Run::Primate is not present ok 7 # skip Required executable for Bio::Tools::Run::Primate is not present ok 8 # skip Required executable for Bio::Tools::Run::Primate is not present ok t/Primer3.t ................... 1..9 ok 1 - use Bio::Tools::Run::Primer3; ok 2 - use Bio::SeqIO; ok 3 ok 4 # skip Primer3 wrapper only supports Primer3 v1 ok 5 # skip Primer3 wrapper only supports Primer3 v1 ok 6 # skip Primer3 wrapper only supports Primer3 v1 ok 7 # skip Primer3 wrapper only supports Primer3 v1 ok 8 # skip Primer3 wrapper only supports Primer3 v1 ok 9 # skip Primer3 wrapper only supports Primer3 v1 ok # Required executable for Bio::Tools::Run::Prints is not present t/Prints.t .................... 1..7 ok 1 - use Bio::Tools::Run::Prints; ok 2 - use Bio::SeqIO; ok 3 - use Bio::Seq; ok 4 - An object of class 'Bio::Tools::Run::Prints' isa 'Bio::Tools::Run::Prints' ok 5 # skip Required executable for Bio::Tools::Run::Prints is not present ok 6 # skip Required executable for Bio::Tools::Run::Prints is not present ok 7 # skip Required executable for Bio::Tools::Run::Prints is not present ok # Required executable for Bio::Tools::Run::Alignment::Probalign is not present t/Probalign.t ................. 1..13 ok 1 - use Bio::Tools::Run::Alignment::Probalign; ok 2 - use Bio::AlignIO; ok 3 - use Bio::SeqIO; ok 4 - use Cwd; ok 5 - use POSIX; ok 6 # skip Required executable for Bio::Tools::Run::Alignment::Probalign is not present ok 7 # skip Required executable for Bio::Tools::Run::Alignment::Probalign is not present ok 8 # skip Required executable for Bio::Tools::Run::Alignment::Probalign is not present ok 9 # skip Required executable for Bio::Tools::Run::Alignment::Probalign is not present ok 10 # skip Required executable for Bio::Tools::Run::Alignment::Probalign is not present ok 11 # skip Required executable for Bio::Tools::Run::Alignment::Probalign is not present ok 12 # skip Required executable for Bio::Tools::Run::Alignment::Probalign is not present ok 13 # skip Required executable for Bio::Tools::Run::Alignment::Probalign is not present ok PROBCONS version 1.12 - align multiple protein sequences and print to standard output Written by Chuong Do Using parameter set: initDistrib[] = { 0.6814756989 8.615339902e-05 8.615339902e-05 0.1591759622 0.1591759622 } gapOpen[] = { 0.0119511066 0.0119511066 0.008008334786 0.008008334786 } gapExtend[] = { 0.3965826333 0.3965826333 0.8988758326 0.8988758326 } Loading sequence file: t/data/cysprot.fa Alignment tree: ((CYS1_DICDI (CATL_HUMAN CATL_RAT)) ((ALEU_HORVU (CATH_HUMAN CATH_RAT)) PAPA_CARPA)) PROBCONS version 1.12 - align multiple protein sequences and print to standard output Written by Chuong Do Using parameter set: initDistrib[] = { 0.6814756989 8.615339902e-05 8.615339902e-05 0.1591759622 0.1591759622 } gapOpen[] = { 0.0119511066 0.0119511066 0.008008334786 0.008008334786 } gapExtend[] = { 0.3965826333 0.3965826333 0.8988758326 0.8988758326 } Loading sequence file: /tmp/XT2ehIXi1D Alignment tree: ((CYS1_DICDI (CATL_HUMAN CATL_RAT)) ((ALEU_HORVU (CATH_HUMAN CATH_RAT)) PAPA_CARPA)) PROBCONS version 1.12 - align multiple protein sequences and print to standard output Written by Chuong Do Using parameter set: initDistrib[] = { 0.6814756989 8.615339902e-05 8.615339902e-05 0.1591759622 0.1591759622 } gapOpen[] = { 0.0119511066 0.0119511066 0.008008334786 0.008008334786 } gapExtend[] = { 0.3965826333 0.3965826333 0.8988758326 0.8988758326 } Loading sequence file: /tmp/pHfLEWLfLV Computing posterior matrix: (1) CYS1_DICDI vs. (2) ALEU_HORVU -- done. Computing posterior matrix: (1) CYS1_DICDI vs. (3) CATH_HUMAN -- done. Computing posterior matrix: (1) CYS1_DICDI vs. (4) CATH_RAT -- done. Computing posterior matrix: (1) CYS1_DICDI vs. (5) CATL_HUMAN -- done. Computing posterior matrix: (1) CYS1_DICDI vs. (6) CATL_RAT -- done. Computing posterior matrix: (1) CYS1_DICDI vs. (7) PAPA_CARPA -- done. Computing posterior matrix: (2) ALEU_HORVU vs. (3) CATH_HUMAN -- done. Computing posterior matrix: (2) ALEU_HORVU vs. (4) CATH_RAT -- done. Computing posterior matrix: (2) ALEU_HORVU vs. (5) CATL_HUMAN -- done. Computing posterior matrix: (2) ALEU_HORVU vs. (6) CATL_RAT -- done. Computing posterior matrix: (2) ALEU_HORVU vs. (7) PAPA_CARPA -- done. Computing posterior matrix: (3) CATH_HUMAN vs. (4) CATH_RAT -- done. Computing posterior matrix: (3) CATH_HUMAN vs. (5) CATL_HUMAN -- done. Computing posterior matrix: (3) CATH_HUMAN vs. (6) CATL_RAT -- done. Computing posterior matrix: (3) CATH_HUMAN vs. (7) PAPA_CARPA -- done. Computing posterior matrix: (4) CATH_RAT vs. (5) CATL_HUMAN -- done. Computing posterior matrix: (4) CATH_RAT vs. (6) CATL_RAT -- done. Computing posterior matrix: (4) CATH_RAT vs. (7) PAPA_CARPA -- done. Computing posterior matrix: (5) CATL_HUMAN vs. (6) CATL_RAT -- done. Computing posterior matrix: (5) CATL_HUMAN vs. (7) PAPA_CARPA -- done. Computing posterior matrix: (6) CATL_RAT vs. (7) PAPA_CARPA -- done. Trained parameter set: initDistrib[] = { 0.8318762183 5.24617426e-05 5.24617426e-05 0.08400939405 0.08400939405 } gapOpen[] = { 0.01386300847 0.01386300847 0.006556313485 0.006556313485 } gapExtend[] = { 0.360332042 0.360332042 0.7831901312 0.7831901312 } PROBCONS version 1.12 - align multiple protein sequences and print to standard output Written by Chuong Do Using parameter set: initDistrib[] = { 0.8318762183 5.246169894e-05 5.246169894e-05 0.08400939405 0.08400939405 } gapOpen[] = { 0.01386300847 0.01386300847 0.006556313485 0.006556313485 } gapExtend[] = { 0.360332042 0.360332042 0.7831901312 0.7831901312 } Loading sequence file: /tmp/W6bKyzoAYG Alignment tree: ((CYS1_DICDI (CATL_HUMAN CATL_RAT)) ((ALEU_HORVU (CATH_HUMAN CATH_RAT)) PAPA_CARPA)) t/Probcons.t .................. 1..11 ok 1 - use Bio::Tools::Run::Alignment::Probcons; ok 2 - use Bio::AlignIO; ok 3 - use Bio::SeqIO; ok 4 - Code tested only on probcons versions > 1.09 ok 5 ok 6 ok 7 ok 8 ok 9 ok 10 ok 11 ok # Required executable for Bio::Tools::Run::Profile is not present t/Profile.t ................... 1..7 ok 1 - use Bio::Tools::Run::Profile; ok 2 - use Bio::SeqIO; ok 3 - use Bio::Seq; ok 4 - An object of class 'Bio::Tools::Run::Profile' isa 'Bio::Tools::Run::Profile' ok 5 # skip Required executable for Bio::Tools::Run::Profile is not present ok 6 # skip Required executable for Bio::Tools::Run::Profile is not present ok 7 # skip Required executable for Bio::Tools::Run::Profile is not present ok t/Promoterwise.t .............. 1..9 ok 1 - use Bio::Tools::Run::Promoterwise; ok 2 - use Bio::Seq; ok 3 - An object of class 'Bio::Tools::Run::Promoterwise' isa 'Bio::Tools::Run::Promoterwise' ok 4 ok 5 ok 6 ok 7 ok 8 ok 9 ok t/ProtDist.t .................. 1..14 ok 1 - use Bio::Tools::Run::Phylo::Phylip::ProtDist; ok 2 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 3 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 4 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 5 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 6 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 7 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 8 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 9 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 10 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 11 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 12 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 13 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 14 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok t/ProtPars.t .................. 1..11 ok 1 - use Bio::Tools::Run::Phylo::Phylip::ProtPars; ok 2 - An object of class 'Bio::Tools::Run::Phylo::Phylip::ProtPars' isa 'Bio::Tools::Run::Phylo::Phylip::ProtPars' ok 3 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 4 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 5 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 6 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 7 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 8 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 9 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 10 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 11 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok # Required executable for Bio::Tools::Run::Pseudowise is not present t/Pseudowise.t ................ 1..18 ok 1 - use Bio::Tools::Run::Pseudowise; ok 2 - use Bio::Root::IO; ok 3 - use Bio::Seq; ok 4 ok 5 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok 6 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok 7 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok 8 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok 9 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok 10 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok 11 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok 12 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok 13 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok 14 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok 15 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok 16 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok 17 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok 18 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok # Required executable for Bio::Tools::Run::Phylo::QuickTree is not present t/QuickTree.t ................. 1..13 ok 1 - use Bio::Tools::Run::Phylo::QuickTree; ok 2 - use Bio::AlignIO; ok 3 - Found input file ok 4 - An object of class 'Bio::Tools::Run::Phylo::QuickTree' isa 'Bio::Tools::Run::Phylo::QuickTree' ok 5 - program_dir returned correct default ok 6 - Correct exe default name ok 7 # skip Required executable for Bio::Tools::Run::Phylo::QuickTree is not present ok 8 # skip Required executable for Bio::Tools::Run::Phylo::QuickTree is not present ok 9 # skip Required executable for Bio::Tools::Run::Phylo::QuickTree is not present ok 10 # skip Required executable for Bio::Tools::Run::Phylo::QuickTree is not present ok 11 # skip Required executable for Bio::Tools::Run::Phylo::QuickTree is not present ok 12 # skip Required executable for Bio::Tools::Run::Phylo::QuickTree is not present ok 13 # skip Required executable for Bio::Tools::Run::Phylo::QuickTree is not present ok t/Raxml.t ..................... 1..12 ok 1 - use Bio::Root::IO; ok 2 - use Bio::Tools::Run::Phylo::Raxml; ok 3 - use Bio::AlignIO; ok 4 - Make the object ok 5 - An object of class 'Bio::Tools::Run::Phylo::Raxml' isa 'Bio::Tools::Run::Phylo::Raxml' ok 6 - Tree is defined ok 7 - Tree is defined ok 8 - File containing best tree exists in tempdir ok 9 - Tree is defined ok 10 - Tree is defined ok 11 - Number of nodes is correct ok 12 - Tree is defined ok # DB and mask make tests # run BLAST methods t/SABlastPlus.t ............... 1..71 ok 1 - use Bio::Tools::Run::StandAloneBlastPlus; ok 2 - use Bio::Tools::Run::WrapperBase; ok 3 - use Bio::Tools::Run::WrapperBase::CommandExts; ok 4 - BlastPlus factory ok 5 - make factory ok 6 - test db made with fasta ok 7 - temp db ok 8 - right type ok 9 ok 10 - named db made ok 11 - check_db ok 12 - correct name ok 13 - dbinfo hash returned ok 14 - correct type ok 15 - windowmasker mask made ok 16 - dustmasker mask made ok 17 - check_db with arg ok 18 - db_info with arg ok 19 - protein db made ok 20 - correct type ok 21 - segmasker mask made ok 22 - segmasker mask made; blastdb as data ok 23 ok 24 - protein db made with pre-built mask ok 25 - db_info records mask info ok 26 ok 27 - mask built and db made on construction (windowmasker) ok 28 ok 29 - mask built and db made on construction (segmasker) ok 30 ok 31 - mask built and db made on construction (dustmasker) ok 32 ok 33 ok 34 ok 35 - make db from Bio::SeqIO ok 36 ok 37 - make db from Bio::AlignIO ok 38 ok 39 - make db from \@seqs ok 40 - dbdir : ./a/b; dbname : test; create ok 41 - make db ok 42 ok 43 ok 44 ok 45 ok 46 - run blastn ok 47 - default hit limit ok 48 - return more alignments (arg spec) ok 49 - got more hits ok 50 - run blastn with Bio::Seq query ok 51 - run tblastn ok 52 - tblastn hits ok 53 - run tblastx ok 54 - tblastx hits ok 55 ok 56 - run blastp ok 57 - blastp hits ok 58 - bl2seq (blastn) ok 59 - got hit ok 60 - bl2seq (tblastx) ok 61 - got hit ok 62 - bl2seq (blastx) ok 63 - got hit ok 64 - bl2seq (blastp) ok 65 - no hit ok 66 - bl2seq (blastp) ok 67 - got hit ok 68 - bl2seq (tblastx) - multiple outfmt options ok 69 - bl2seq (tblastx) - multiple outfmt options (use method arg) ok 70 - bl2seq (tblastx) - multiple outfmt options (no explict quotes should also work) ok 71 - bl2seq (tblastx) - multiple outfmt options (a single format number in quotes ok # Required executable for Bio::Tools::Run::Phylo::SLR is not present t/SLR.t ....................... 1..7 ok 1 - use Bio::Root::IO; ok 2 - use Bio::Tools::Run::Phylo::SLR; ok 3 - use Bio::AlignIO; ok 4 - use Bio::TreeIO; ok 5 ok 6 # skip Required executable for Bio::Tools::Run::Phylo::SLR is not present ok 7 # skip Required executable for Bio::Tools::Run::Phylo::SLR is not present ok # Required executable for Bio::Tools::Run::Samtools is not present t/Samtools.t .................. 1..41 ok 1 - make a factory using command 'pileup' ok 2 - parameters changed on construction ok 3 - access parameter ok 4 - parameters_changed cleared on read ok 5 - set a param not set in constructor ok 6 - parameters_changed set ok 7 - parameter really set ok 8 - original parameter unchanged ok 9 - parameters_changed cleared on read ok 10 - change an original parameter ok 11 - parameter really changed ok 12 - reset parameters with arg ok 13 - original parameters undefined ok 14 - parameter really reset via arg ok 15 - parameters changed ok 16 - all available options ok 17 - available parameters ok 18 - available switches ok 19 - get_parameters correct ok 20 - command attribute set ok 21 - internal command array set ok 22 - internal prefix hash set ok 23 - commands filtered by prefix ok 24 - translate_params: command correct ok 25 - translate_params: options correct ok 26 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 27 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 28 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 29 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 30 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 31 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 32 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 33 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 34 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 35 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 36 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 37 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 38 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 39 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 40 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 41 # skip Required executable for Bio::Tools::Run::Samtools is not present ok # Required executable for Bio::Tools::Run::Seg is not present t/Seg.t ....................... 1..8 ok 1 - use Bio::Tools::Run::Seg; ok 2 - use Bio::SeqIO; ok 3 - use Bio::Seq; ok 4 - An object of class 'Bio::Tools::Run::Seg' isa 'Bio::Tools::Run::Seg' ok 5 # skip Required executable for Bio::Tools::Run::Seg is not present ok 6 # skip Required executable for Bio::Tools::Run::Seg is not present ok 7 # skip Required executable for Bio::Tools::Run::Seg is not present ok 8 # skip Required executable for Bio::Tools::Run::Seg is not present ok # Required executable for Bio::Tools::Run::Phylo::Semphy is not present t/Semphy.t .................... 1..19 ok 1 - use Bio::Tools::Run::Phylo::Semphy; ok 2 - An object of class 'Bio::Tools::Run::Phylo::Semphy' isa 'Bio::Tools::Run::Phylo::Semphy' ok 3 - has a created method not in args ok 4 - ratio param was set via -z ok 5 - jtt switch was set ok 6 - program_dir returned correct default ok 7 - Correct exe default name ok 8 # skip Required executable for Bio::Tools::Run::Phylo::Semphy is not present ok 9 # skip Required executable for Bio::Tools::Run::Phylo::Semphy is not present ok 10 # skip Required executable for Bio::Tools::Run::Phylo::Semphy is not present ok 11 # skip Required executable for Bio::Tools::Run::Phylo::Semphy is not present ok 12 # skip Required executable for Bio::Tools::Run::Phylo::Semphy is not present ok 13 # skip Required executable for Bio::Tools::Run::Phylo::Semphy is not present ok 14 # skip Required executable for Bio::Tools::Run::Phylo::Semphy is not present ok 15 # skip Required executable for Bio::Tools::Run::Phylo::Semphy is not present ok 16 # skip Required executable for Bio::Tools::Run::Phylo::Semphy is not present ok 17 # skip Required executable for Bio::Tools::Run::Phylo::Semphy is not present ok 18 # skip Required executable for Bio::Tools::Run::Phylo::Semphy is not present ok 19 # skip Required executable for Bio::Tools::Run::Phylo::Semphy is not present ok # Required executable for Bio::Tools::Run::Phylo::Phylip::SeqBoot is not present t/SeqBoot.t ................... 1..9 ok 1 - use Bio::Tools::Run::Phylo::Phylip::SeqBoot; ok 2 - use Bio::AlignIO; ok 3 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::SeqBoot is not present ok 4 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::SeqBoot is not present ok 5 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::SeqBoot is not present ok 6 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::SeqBoot is not present ok 7 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::SeqBoot is not present ok 8 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::SeqBoot is not present ok 9 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::SeqBoot is not present ok # Required executable for Bio::Tools::Run::Signalp is not present t/Signalp.t ................... 1..7 ok 1 - use Bio::Tools::Run::Signalp; ok 2 - use Bio::SeqIO; ok 3 - use Bio::Seq; ok 4 - An object of class 'Bio::Tools::Run::Signalp' isa 'Bio::Tools::Run::Signalp' ok 5 # skip Required executable for Bio::Tools::Run::Signalp is not present ok 6 # skip Required executable for Bio::Tools::Run::Signalp is not present ok 7 # skip Required executable for Bio::Tools::Run::Signalp is not present ok t/Sim4.t ...................... 1..23 ok 1 - use Bio::Tools::Run::Alignment::Sim4; ok 2 - use Bio::SimpleAlign; ok 3 - use Bio::AlignIO; ok 4 - use Bio::SeqIO; ok 5 - An object of class 'Bio::Tools::Run::Alignment::Sim4' isa 'Bio::Tools::Run::Alignment::Sim4' ok 6 ok 7 ok 8 ok 9 ok 10 ok 11 ok 12 ok 13 ok 14 ok 15 ok 16 ok 17 ok 18 ok 19 ok 20 ok 21 ok 22 ok 23 ok # Required executable for Bio::Tools::Run::Simprot is not present t/Simprot.t ................... 1..6 ok 1 - use Bio::Root::IO; ok 2 - use Bio::Tools::Run::Simprot; ok 3 - use Bio::AlignIO; ok 4 - use Bio::TreeIO; ok 5 ok 6 # skip Required executable for Bio::Tools::Run::Simprot is not present ok t/SoapEU-function.t ........... skipped: The optional module Bio::DB::ESoap (or dependencies thereof) was not installed t/SoapEU-unit.t ............... skipped: The optional module Bio::DB::ESoap (or dependencies thereof) was not installed # Required executable for Bio::Tools::Run::Alignment::StandAloneFasta is not present t/StandAloneFasta.t ........... 1..15 ok 1 - use Bio::Tools::Run::Alignment::StandAloneFasta; ok 2 - use Bio::SeqIO; ok 3 ok 4 # skip Required executable for Bio::Tools::Run::Alignment::StandAloneFasta is not present ok 5 # skip Required executable for Bio::Tools::Run::Alignment::StandAloneFasta is not present ok 6 # skip Required executable for Bio::Tools::Run::Alignment::StandAloneFasta is not present ok 7 # skip Required executable for Bio::Tools::Run::Alignment::StandAloneFasta is not present ok 8 # skip Required executable for Bio::Tools::Run::Alignment::StandAloneFasta is not present ok 9 # skip Required executable for Bio::Tools::Run::Alignment::StandAloneFasta is not present ok 10 # skip Required executable for Bio::Tools::Run::Alignment::StandAloneFasta is not present ok 11 # skip Required executable for Bio::Tools::Run::Alignment::StandAloneFasta is not present ok 12 # skip Required executable for Bio::Tools::Run::Alignment::StandAloneFasta is not present ok 13 # skip Required executable for Bio::Tools::Run::Alignment::StandAloneFasta is not present ok 14 # skip Required executable for Bio::Tools::Run::Alignment::StandAloneFasta is not present ok 15 # skip Required executable for Bio::Tools::Run::Alignment::StandAloneFasta is not present ok # Required executable for Bio::Tools::Run::Tmhmm is not present t/Tmhmm.t ..................... 1..9 ok 1 - use Bio::Tools::Run::Tmhmm; ok 2 - use Bio::SeqIO; ok 3 - An object of class 'Bio::Tools::Run::Tmhmm' isa 'Bio::Tools::Run::Tmhmm' ok 4 # skip Required executable for Bio::Tools::Run::Tmhmm is not present ok 5 # skip Required executable for Bio::Tools::Run::Tmhmm is not present ok 6 # skip Required executable for Bio::Tools::Run::Tmhmm is not present ok 7 # skip Required executable for Bio::Tools::Run::Tmhmm is not present ok 8 # skip Required executable for Bio::Tools::Run::Tmhmm is not present ok 9 # skip Required executable for Bio::Tools::Run::Tmhmm is not present ok t/TribeMCL.t .................. 1..24 ok 1 - use Bio::Tools::Run::TribeMCL; ok 2 - use Bio::SearchIO; ok 3 - An object of class 'Bio::Tools::Run::TribeMCL' isa 'Bio::Tools::Run::TribeMCL' ok 4 # skip Tribe Matrix program not found. Skipping tests... ok 5 # skip Tribe Matrix program not found. Skipping tests... ok 6 # skip Tribe Matrix program not found. Skipping tests... ok 7 # skip Tribe Matrix program not found. Skipping tests... ok 8 # skip Tribe Matrix program not found. Skipping tests... ok 9 # skip Tribe Matrix program not found. Skipping tests... ok 10 # skip Tribe Matrix program not found. Skipping tests... ok 11 # skip Tribe Matrix program not found. Skipping tests... ok 12 # skip Tribe Matrix program not found. Skipping tests... ok 13 # skip Tribe Matrix program not found. Skipping tests... ok 14 # skip Tribe Matrix program not found. Skipping tests... ok 15 # skip Tribe Matrix program not found. Skipping tests... ok 16 # skip Tribe Matrix program not found. Skipping tests... ok 17 # skip Tribe Matrix program not found. Skipping tests... ok 18 # skip Tribe Matrix program not found. Skipping tests... ok 19 # skip Tribe Matrix program not found. Skipping tests... ok 20 # skip Tribe Matrix program not found. Skipping tests... ok 21 # skip Tribe Matrix program not found. Skipping tests... ok 22 # skip Tribe Matrix program not found. Skipping tests... ok 23 # skip Tribe Matrix program not found. Skipping tests... ok 24 # skip Tribe Matrix program not found. Skipping tests... ok t/Vista.t ..................... 1..7 ok 1 - use Bio::Tools::Run::Vista; ok 2 - use Bio::AlignIO; ok 3 # skip Skipping due to old java version ok 4 # skip Skipping due to old java version ok 5 # skip Skipping due to old java version ok 6 # skip Skipping due to old java version ok 7 # skip Skipping due to old java version ok # Required executable for Bio::Tools::Run::Alignment::Gmap is not present t/gmap-run.t .................. 1..8 ok 1 - use Bio::Tools::Run::Alignment::Gmap; ok 2 # skip Required executable for Bio::Tools::Run::Alignment::Gmap is not present ok 3 # skip Required executable for Bio::Tools::Run::Alignment::Gmap is not present ok 4 # skip Required executable for Bio::Tools::Run::Alignment::Gmap is not present ok 5 # skip Required executable for Bio::Tools::Run::Alignment::Gmap is not present ok 6 # skip Required executable for Bio::Tools::Run::Alignment::Gmap is not present ok 7 # skip Required executable for Bio::Tools::Run::Alignment::Gmap is not present ok 8 # skip Required executable for Bio::Tools::Run::Alignment::Gmap is not present ok # Required executable for Bio::Tools::Run::tRNAscanSE is not present t/tRNAscanSE.t ................ 1..12 ok 1 - use Bio::Tools::Run::tRNAscanSE; ok 2 - use Bio::Root::IO; ok 3 - use Bio::Seq; ok 4 - An object of class 'Bio::Tools::Run::tRNAscanSE' isa 'Bio::Tools::Run::tRNAscanSE' ok 5 # skip Required executable for Bio::Tools::Run::tRNAscanSE is not present ok 6 # skip Required executable for Bio::Tools::Run::tRNAscanSE is not present ok 7 # skip Required executable for Bio::Tools::Run::tRNAscanSE is not present ok 8 # skip Required executable for Bio::Tools::Run::tRNAscanSE is not present ok 9 # skip Required executable for Bio::Tools::Run::tRNAscanSE is not present ok 10 # skip Required executable for Bio::Tools::Run::tRNAscanSE is not present ok 11 # skip Required executable for Bio::Tools::Run::tRNAscanSE is not present ok 12 # skip Required executable for Bio::Tools::Run::tRNAscanSE is not present ok All tests successful. Files=60, Tests=1652, 444 wallclock secs ( 0.60 usr 0.20 sys + 199.12 cusr 7.08 csys = 207.00 CPU) Result: PASS mv t.skip/* t rm -rf t.skip make[1]: Leaving directory '/build/reproducible-path/bioperl-run-1.7.3' create-stamp debian/debhelper-build-stamp dh_prep dh_auto_install /usr/bin/perl Build install --destdir /build/reproducible-path/bioperl-run-1.7.3/debian/tmp --create_packlist 0 Building BioPerl-Run Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man1/bp_papplmaker.pl.1p Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man1/bp_multi_hmmsearch.pl.1p Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man1/bp_panalysis.pl.1p Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man1/bp_run_protdist.pl.1p Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man1/bp_run_neighbor.pl.1p Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Factory/EMBOSS.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/StandAloneNCBIBlast.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/MCS.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/RepeatMasker.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Vista.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Match.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Ensembl.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Profile.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/StandAloneBlastPlus.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/StandAloneBlast.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/FootPrinter.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/BEDTools.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/TribeMCL.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/StandAloneWUBlast.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Primate.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Promoterwise.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/BlastPlus.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/RNAMotif.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Genewise.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Infernal.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/tRNAscanSE.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Tmhmm.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Eponine.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Pseudowise.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Hmmer.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/ERPIN.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Seg.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Samtools.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Simprot.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Coil.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Mdust.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/EMBOSSApplication.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Genemark.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Genscan.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Primer3.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Prints.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/EMBOSSacd.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Signalp.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Glimmer.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/Probcons.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/Lagan.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/Sim4.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/Muscle.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/Proda.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/Kalign.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/Blat.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/Gmap.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/Amap.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/Pal2Nal.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/StandAloneFasta.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/MSAProbs.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/DBA.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/Probalign.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/MAFFT.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/Exonerate.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Analysis/soap.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Samtools/Config.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/StandAloneBlastPlus/BlastMethods.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/AnalysisFactory/soap.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Semphy.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Gerp.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/QuickTree.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Raxml.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/LVB.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Phyml.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/SLR.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/FastTree.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Njtree/Best.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Hyphy/BatchFile.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Hyphy/REL.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Hyphy/Base.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Hyphy/SLAC.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Hyphy/FEL.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Hyphy/Modeltest.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Phast/PhastCons.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Phast/PhyloFit.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Phylip/DrawGram.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Phylip/ProtPars.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Phylip/SeqBoot.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Phylip/Neighbor.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Phylip/PhylipConf.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Phylip/Consense.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Phylip/Base.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Phylip/ProtDist.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Phylip/DrawTree.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Molphy/ProtML.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/BlastPlus/Config.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/BEDTools/Config.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/DB/SoapEUtilities.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/DB/ESoap.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/DB/ESoap/WSDL.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/DB/SoapEUtilities/FetchAdaptor.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/DB/SoapEUtilities/LinkAdaptor.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/DB/SoapEUtilities/GQueryAdaptor.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/DB/SoapEUtilities/DocSumAdaptor.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/DB/SoapEUtilities/Result.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/DB/SoapEUtilities/FetchAdaptor/seq.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/DB/SoapEUtilities/FetchAdaptor/species.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Hyphy::BatchFile.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Phylip::Base.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Phylip::DrawGram.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::Probcons.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Samtools::Config.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::StandAloneBlastPlus.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Phylip::SeqBoot.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Phyml.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::Proda.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::LVB.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Molphy::ProtML.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::Blat.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::DB::SoapEUtilities::Result.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Simprot.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::FootPrinter.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Phylip::Consense.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Primer3.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Phylip::ProtPars.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::MAFFT.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Hyphy::Base.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::FastTree.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Genscan.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Ensembl.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::TribeMCL.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::MSAProbs.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::DB::SoapEUtilities::LinkAdaptor.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::EMBOSSacd.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::Kalign.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Hmmer.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::StandAloneWUBlast.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Profile.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::tRNAscanSE.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Promoterwise.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::RNAMotif.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Signalp.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::MCS.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::Exonerate.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::Lagan.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Seg.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::BlastPlus.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Tmhmm.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Analysis::soap.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::StandAloneBlast.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::StandAloneBlastPlus::BlastMethods.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::AnalysisFactory::soap.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Phast::PhastCons.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Gerp.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Genewise.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::QuickTree.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::Pal2Nal.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Coil.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Hyphy::SLAC.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::StandAloneNCBIBlast.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Phylip::PhylipConf.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::BEDTools.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::DB::SoapEUtilities::DocSumAdaptor.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::ERPIN.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::Muscle.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::Probalign.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::Sim4.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Phylip::ProtDist.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Phast::PhyloFit.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Hyphy::Modeltest.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::DBA.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::DB::SoapEUtilities::GQueryAdaptor.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::RepeatMasker.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Primate.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::Amap.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Match.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::DB::SoapEUtilities::FetchAdaptor::species.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::EMBOSSApplication.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Infernal.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Glimmer.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Factory::EMBOSS.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Prints.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Phylip::Neighbor.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Raxml.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::DB::SoapEUtilities.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::BEDTools::Config.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Genemark.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::DB::ESoap::WSDL.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Samtools.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::Gmap.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::DB::SoapEUtilities::FetchAdaptor::seq.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::DB::SoapEUtilities::FetchAdaptor.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Njtree::Best.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Mdust.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Phylip::DrawTree.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Hyphy::REL.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::SLR.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Semphy.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::StandAloneFasta.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Vista.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::DB::ESoap.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Eponine.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Hyphy::FEL.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Pseudowise.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/bin/bp_multi_hmmsearch.pl Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/bin/bp_run_protdist.pl Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/bin/bp_papplmaker.pl Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/bin/bp_panalysis.pl Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/bin/bp_run_neighbor.pl dh_install dh_installdocs dh_installchangelogs dh_installman dh_lintian dh_perl dh_link dh_strip_nondeterminism dh_compress dh_fixperms dh_missing dh_installdeb dh_gencontrol dh_md5sums dh_builddeb dpkg-deb: building package 'libbio-perl-run-perl' in '../libbio-perl-run-perl_1.7.3-11_all.deb'. dpkg-deb: building package 'bioperl-run' in '../bioperl-run_1.7.3-11_all.deb'. dpkg-genbuildinfo --build=binary -O../bioperl-run_1.7.3-11_armhf.buildinfo dpkg-genchanges --build=binary -O../bioperl-run_1.7.3-11_armhf.changes dpkg-genchanges: info: binary-only upload (no source code included) dpkg-source --after-build . dpkg-buildpackage: info: binary-only upload (no source included) dpkg-genchanges: info: not including original source code in upload I: copying local configuration I: user script /srv/workspace/pbuilder/10412/tmp/hooks/B01_cleanup starting I: user script /srv/workspace/pbuilder/10412/tmp/hooks/B01_cleanup finished I: unmounting dev/ptmx filesystem I: unmounting dev/pts filesystem I: unmounting dev/shm filesystem I: unmounting proc filesystem I: unmounting sys filesystem I: cleaning the build env I: removing directory /srv/workspace/pbuilder/10412 and its subdirectories I: Current time: Sun Apr 28 20:35:13 +14 2024 I: pbuilder-time-stamp: 1714286113